![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0012.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining in human cervix, uterine and skeletal muscle tissues using anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CKAP4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CKAP4 |
![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 (A) shows similar protein distribution across tissues to independent antibody NBP1-85572 (B).](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0013.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow, cerebral cortex, cervix, uterine and skeletal muscle using Anti-CKAP4 antibody NBP1-85571 (A) shows similar protein distribution across tissues to independent antibody NBP1-85572 (B).")
![Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Western-Blot-NBP1-85571-img0009.jpg "Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Analysis in human cell lines U-251MG and MCF-7 using Anti-CKAP4 antibody. Corresponding CKAP4 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.")
![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human skeletal muscle using Anti-CKAP4 antibody NBP1-85571.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0019.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human skeletal muscle using Anti-CKAP4 antibody NBP1-85571.")
![Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Western-Blot-NBP1-85571-img0007.jpg "Western Blot: CKAP4/p63 Antibody [NBP1-85571] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.")
![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0010.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine shows high expression.")
![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow using Anti-CKAP4 antibody.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0016.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human bone marrow using Anti-CKAP4 antibody.")
![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cerebral cortex using Anti-CKAP4 antibody.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0017.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cerebral cortex using Anti-CKAP4 antibody.")
![Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine using Anti-CKAP4 antibody NBP1-85571.](http://images.novusbio.com/fullsize/CKAP4-p63-Antibody-Immunohistochemistry-Paraffin-NBP1-85571-img0018.jpg "Immunohistochemistry-Paraffin: CKAP4/p63 Antibody [NBP1-85571] - Staining of human cervix, uterine using Anti-CKAP4 antibody NBP1-85571.")
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")