Home » CHX10 » CHX10 Proteins » Recombinant Human CHX10 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human CHX10 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human CHX10 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-361 of Human CHX10

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
VSX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
65.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CHX10 GST (N-Term) Protein

  • ceh-10 homeo domain containing homolog (C. elegans)
  • ceh-10 homeo domain containing homolog
  • ceh-10 homeodomain containing homolog (C. elegans)
  • Ceh-10 homeodomain-containing homolog
  • CHX10MCOPCB3
  • Homeobox protein CHX10
  • HOX10C elegans ceh-10 homeo domain-containing homolog
  • MCOP2
  • RET1
  • visual system homeobox 2

Background

The CHX10 gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in thisgene are associated with microphthalmia, cataracts and iris abnormalities. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
RAX Antibody
NB100-56467
Western Blot RAX Antibody
Species: Ca, Hu, Pm
Applications: WB
Nestin Antibody
(196908) [Unconjugate
MAB1259
Immunocytochemistry Nestin Antibody (196908) [Unconjugated]
Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]
Western Blot Nestin Antibody (196908) [Unconjugated]
(3 Reviews)
(161 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
VSX1 Antibody
NBP3-25228
Immunocytochemistry/ Immunofluorescence VSX1 Antibody
Species: Hu
Applications: ICC/IF
Otx2 Antibody
[Unconjugated]
AF1979
Immunocytochemistry Otx2 Antibody [Unconjugated]
Immunohistochemistry Otx2 Antibody [Unconjugated]
Simple Western Otx2 Antibody [Unconjugated]
(2 Reviews)
(178 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
MITF Antibody
AF5769
Western Blot MITF Antibody
Immunohistochemistry MITF Antibody
(9 Publications)
Species: Hu
Applications: IHC, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(371 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry Rhodopsin Antibody (B630)
Western Blot Rhodopsin Antibody (B630)
Immunocytochemistry/ Immunofluorescence Rhodopsin Antibody (B630)
(9 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
SIX3 Antibody (1A2)
H00006496-M04
Western Blot SIX3 Antibody (1A2)
Western Blot SIX3 Antibody (1A2)
Western Blot SIX3 Antibody (1A2)
Species: Hu
Applications: ELISA, WB
SIX6 Antibody
NBP1-82478
Western Blot SIX6 Antibody
Immunocytochemistry/ Immunofluorescence SIX6 Antibody
Immunohistochemistry-Paraffin SIX6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RPE Antibody
NBP3-35469
Immunocytochemistry/ Immunofluorescence RPE Antibody
Western Blot RPE Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Recoverin Antibody
NBP3-38258
Immunohistochemistry Recoverin Antibody
Immunocytochemistry/ Immunofluorescence Recoverin Antibody
Immunohistochemistry Recoverin Antibody
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PKR Antibody
(HL71/10) [Unconjugat
MAB1980
Simple Western PKR Antibody (HL71/10) [Unconjugated]
Immunocytochemistry PKR Antibody (HL71/10) [Unconjugated]
Western Blot PKR Antibody (HL71/10) [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, IP, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(852 Publications)
Species: Hu
Applications: BA
p27/Kip1 [p
Thr198] Antibody [Unc ...
AF3994
Western Blot p27/Kip1 [p Thr198] Antibody [Unconjugated]
(19 Publications)
Species: Hu
Applications: WB
LHX2 Antibody
(CL6137)
NBP2-61435
Immunohistochemistry-Paraffin LHX2 Antibody (CL6137)
Western Blot LHX2 Antibody (CL6137)
Western Blot LHX2 Antibody (CL6137)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
GFAP Antibody
NB300-141
Immunohistochemistry GFAP Antibody
Western Blot GFAP Antibody
Western Blot GFAP Antibody
(12 Reviews)
(108 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ATOH7 Antibody
(1A5)
H00220202-M01
Western Blot ATOH7 Antibody (1A5)
(1 Publication)
Species: Hu
Applications: ELISA, WB
Recombinant Human
CHX10 GST (N-Term) Pr ...
H00338917-P01
Recombinant Human CHX10 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for CHX10 Recombinant Protein (H00338917-P01) (0)

There are no publications for CHX10 Recombinant Protein (H00338917-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHX10 Recombinant Protein (H00338917-P01) (0)

There are no reviews for CHX10 Recombinant Protein (H00338917-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHX10 Recombinant Protein (H00338917-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CHX10 Products

Array H00338917-P01

Research Areas for CHX10 Recombinant Protein (H00338917-P01)

Find related products by research area.

Blogs on CHX10

There are no specific blogs for CHX10, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CHX10 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol VSX2