![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of human lymph node shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/Choline-Acetyltransferase-ChAT-Antibody-Immunohistochemistry-Paraffin-NBP2-33530-img0009.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of human lymph node shows no positivity in lymphoid cells as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTN |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHAT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Choline Acetyltransferase/ChAT Antibody (NBP2-33530)Find related products by research area.
|
|
Choline Acetyltransferase (ChAT) – a useful Immunohistochemical marker for morphological studies of neurons Choline Acetyltransferase (ChAT) is the enzyme that is responsible for biosynthesis of the neurotransmitter acetylcholine. The majority of acetylcholine is synthesized locally at nerve terminals where ChAT catalyzes the transfer of an acetyl group ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of mouse basal forebrain shows strong cytoplasmic positivity in neuronal cells and fibers.](http://images.novusbio.com/fullsize/Choline-Acetyltransferase-ChAT-Antibody-Immunohistochemistry-Paraffin-NBP2-33530-img0006.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of mouse basal forebrain shows strong cytoplasmic positivity in neuronal cells and fibers.")
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of mouse cerebellum shows positivity in a subset of neural fiber endings.](http://images.novusbio.com/fullsize/Choline-Acetyltransferase-ChAT-Antibody-Immunohistochemistry-Paraffin-NBP2-33530-img0007.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of mouse cerebellum shows positivity in a subset of neural fiber endings.")
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of human caudate nucleus shows strong cytoplasmic positivity in a large neurons.](http://images.novusbio.com/fullsize/Choline-Acetyltransferase-ChAT-Antibody-Immunohistochemistry-Paraffin-NBP2-33530-img0008.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of human caudate nucleus shows strong cytoplasmic positivity in a large neurons.")
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells.](http://images.novusbio.com/fullsize/Choline-Acetyltransferase-ChAT-Antibody-Immunohistochemistry-Paraffin-NBP2-33530-img0010.jpg "Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP2-33530] - Staining of human small intestine shows strong cytoplasmic positivity in neuroendocrine cells.")
![SDS-PAGE beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_321.jpg)
![Bioactivity beta-NGF [Unconjugated]](https://images.novusbio.com/images2/beta-NGF_256-GF_322.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Immunohistochemistry NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Immunohistochemistry_6685.jpg)
![Western Blot NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Western_Blot_17941.jpg)
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")