CHD5 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CHD5 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for CHD5 Antibody - BSA Free
Background
Changes in gene expression are associated with changes in chromatin structure, which can result from modification of histones by acetylation and methylation. In addition, SWI/SNF proteins can effect chromatin structure and gene expression by causing ATP-dependent disruption of the nucleosome and by enhancing binding of transcription factors. CHD5 belongs to a group of SWI/SNF proteins called CHD proteins, which contain a SWI/SNF-like helicase/ATPase domain, as well as a DNA-binding domain and a chromodomain that directly modifies chromatin structure (Thompson et al., 2003 (PubMed 12592387)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC, KO, WB
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, KO, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Bind
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Publications for CHD5 Antibody (NBP2-49186) (0)
There are no publications for CHD5 Antibody (NBP2-49186).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CHD5 Antibody (NBP2-49186) (0)
There are no reviews for CHD5 Antibody (NBP2-49186).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for CHD5 Antibody (NBP2-49186) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CHD5 Products
Research Areas for CHD5 Antibody (NBP2-49186)
Find related products by research area.
|
Blogs on CHD5