cGK1/PRKG1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: LADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEA |
Predicted Species |
Mouse (99%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PRKG1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for cGK1/PRKG1 Antibody
Background
cGK1/PRKG1, also known as cGMP-dependent protein kinase 1, has two isoforms that are produced by alternative splicing. Isoform Alpha (CGK1-alpha) is 671 amino acids long and 76 kDa. Isoform Beta (CGK1-beta) is 686 amino acids long and approximately 78 kDa. PRKG1 is a Serine/threonine protein kinase that is expressed in placenta and lung. cGK1/PRKG1 is an important player in the Nitric Oxide/cGMP Signaling Pathway; the binding of GMP activates PRKG1, which in turn phosphorylates Serine residues and Threonine residues on various cell proteins, including proteins that regulate calcium levels, smooth muscle contraction, platelet adhesion, circadian rhythm and more. Current research on PRKG1 is being conducted in relation to several diseases and disorders including cystic fibrosis, lymphoma, non-small cell lung carcinoma, Wiskott-Aldrich syndrome, Waterhouse-Friderichsen syndrome and myoglobinuria. PRKG1 has also been shown to have interactions with SMAD4, BMPR2, GKAP1, Natriuretic Peptide Receptor A and TFII-I in pathways such as Gap Junction signaling, eNOS signaling and EDNRB signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC
Publications for cGK1/PRKG1 Antibody (NBP1-87289) (0)
There are no publications for cGK1/PRKG1 Antibody (NBP1-87289).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for cGK1/PRKG1 Antibody (NBP1-87289) (0)
There are no reviews for cGK1/PRKG1 Antibody (NBP1-87289).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for cGK1/PRKG1 Antibody (NBP1-87289) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional cGK1/PRKG1 Products
Research Areas for cGK1/PRKG1 Antibody (NBP1-87289)
Find related products by research area.
|
Blogs on cGK1/PRKG1