cGK1/PRKG1 Antibody (2B3) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
PRKG1 (NP_006249, 73 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV |
Specificity |
protein kinase, cGMP-dependent, type I |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PRKG1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for cGK1/PRKG1 Antibody (2B3)
Background
cGK1/PRKG1, also known as cGMP-dependent protein kinase 1, has two isoforms that are produced by alternative splicing. Isoform Alpha (CGK1-alpha) is 671 amino acids long and 76 kDa. Isoform Beta (CGK1-beta) is 686 amino acids long and approximately 78 kDa. PRKG1 is a Serine/threonine protein kinase that is expressed in placenta and lung. cGK1/PRKG1 is an important player in the Nitric Oxide/cGMP Signaling Pathway; the binding of GMP activates PRKG1, which in turn phosphorylates Serine residues and Threonine residues on various cell proteins, including proteins that regulate calcium levels, smooth muscle contraction, platelet adhesion, circadian rhythm and more. Current research on PRKG1 is being conducted in relation to several diseases and disorders including cystic fibrosis, lymphoma, non-small cell lung carcinoma, Wiskott-Aldrich syndrome, Waterhouse-Friderichsen syndrome and myoglobinuria. PRKG1 has also been shown to have interactions with SMAD4, BMPR2, GKAP1, Natriuretic Peptide Receptor A and TFII-I in pathways such as Gap Junction signaling, eNOS signaling and EDNRB signaling.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, IHC
Publications for cGK1/PRKG1 Antibody (H00005592-M03) (0)
There are no publications for cGK1/PRKG1 Antibody (H00005592-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for cGK1/PRKG1 Antibody (H00005592-M03) (0)
There are no reviews for cGK1/PRKG1 Antibody (H00005592-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for cGK1/PRKG1 Antibody (H00005592-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional cGK1/PRKG1 Products
Research Areas for cGK1/PRKG1 Antibody (H00005592-M03)
Find related products by research area.
|
Blogs on cGK1/PRKG1