cGK2/PRKG2 Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human cGK2/PRKG2 (NP_006250.1).
Sequence: MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLIT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PRKG2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunoprecipitation 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
87 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for cGK2/PRKG2 Antibody
Background
cGK2/PRKG2, also known as cGMP-dependent protein kinase 2, is 762 amino acids long and approximately 87kDa. cGK2/PRKG2 is a protein kinase that is highly expressed in the brain, intestine and lung. Current research surrounding cGK2/PRKG2 has shown a potential link with several disorders and diseases including cystic fibrosis, gout, malaria, lung cancer, alcoholism, diarrhea, and hyperphenylalaninemia. cGK2/PRKG2 may also interact with PTS, LASP1, YWHAB, MYLK, and PLCB3 in pathways such as cGMP signaling, platelet homeostasis, EDNRB signaling, signaling in gap junctions, nitric oxide metabolism, and eNOS activation and regulation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
Publications for cGK2/PRKG2 Antibody (NBP3-35308) (0)
There are no publications for cGK2/PRKG2 Antibody (NBP3-35308).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for cGK2/PRKG2 Antibody (NBP3-35308) (0)
There are no reviews for cGK2/PRKG2 Antibody (NBP3-35308).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for cGK2/PRKG2 Antibody (NBP3-35308) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional cGK2/PRKG2 Products
Research Areas for cGK2/PRKG2 Antibody (NBP3-35308)
Find related products by research area.
|
Blogs on cGK2/PRKG2