Genetic Strategies: Western Blot: CDC42EP1 Antibody [NBP1-88379] - HeLa whole cell lysate. Lanes 1 and 4: HeLa cells transfected with control non-targeting siRNA. Lanes 2 and 3: HeLa cells transfected with two ...read more
Immunocytochemistry/ Immunofluorescence: CDC42EP1 Antibody [NBP1-88379] - Confocal Imunofluorescent images of HeLa cells fixed with PFA and stained with Cdc42EP1 antibody at 1:200 (magenta), and phalloidin-Alexa 488 ...read more
Immunohistochemistry-Paraffin: CDC42EP1 Antibody [NBP1-88379] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: CDC42EP1 Antibody [NBP1-88379] - Staining of human cell line A-431 shows localization to plasma membrane & actin filaments. Antibody staining is shown in green.
Immunoprecipitation: CDC42EP1 Antibody [NBP1-88379] - Lanes 1 and 5: Marker. Lanes 2-4 HeLa cell input controls. Lane 6: IP using 2 mg of Control Rabbit IgG cell lysate. Lane 8: IP using 2 mg Cdc42EP1 cell lysate and ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: SGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42EP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for CDC42EP1 Antibody
Binder of Rho GTPases 5
Borg5
BORG5cdc42 effector protein 1
CDC42 effector protein (Rho GTPase binding) 1
CEP155 kDa bone marrow stromal/endothelial cell protein
MSE55MGC15316
serum constituent protein
Serum protein MSE55
Background
CDC42EP1, also known as CDC42 Effector Protein 1, consists of a 40.2 kDa and 39.7 kDa isoform, and is involved in regulatory processes within the cell as a member of the Rho GTPase family. Most commonly found in bone marrow, the CDC42EP1 proteins been shown to help facilitate actin cytoskeleton restructuring and cell shape regulation. The protein is being studied for its involvement in osteonecrosis. The protein has been linked to the RhoA and Rho GTPases pathways where it interacts with MAPKAP1, RPTOR, RHOQ, CDC42, RBPMS, KRTAP4-12, PLSCR1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Cells fixed with 4% PFA for 20 minutes room temperature.
Fixed cells incubated with with 0.5% triton x100 in 1xPBS for 5 minutes room.
Washed twice in blocking buffer (1% BSA 1xPBS, 20mM glycine).
Washed once with blocking buffer left for 1hour room temperature.
incubated with Anti Cdc42EP1 antibody in blocking buffer 1:200 for 20 hours at 4 degrees.
Washed 3 x 5 minutes in blocking buffer
Incubated with Anti rabbit-Alexa 594 conjugated antibody (Jackson immunoscience) for 2 hours room temperature.
Washed 3 x 5 minutes in blocking buffer
Washed 1 x 5 minutes in PBS
Imaged with 60X oil objective on Nikon Eclipse Ti Inverted Fast confocal - Equipped with a Yokogawa CSU-X1 spinning disk unit and okogawa CSU-1 disk head and Andor Neo sCMOS camera.
Put all microfuge tubes that you are going to use on ice
Cool centrifuge to 4°C
Take HeLa cells grown on 10cm dishes to about 70% confluence
Aspirate media wash twice with 10ml cold 1xPBS
Add 1 ml of lysis buffer + 1xphosphatase + 1xprotease inhibtors (Roche) to each 10cm plate
Scrape cells off plate
Syringe 7-8 times with 25 G needle
Transfer to microfuge tube on ice
pre clear lysate by adding 60 μl of mag protein G beads (NEB) to each 1 ml of lysate
Leave on ice for 10 min inverting several times.
Spin tubes in cool centrifuge max speed 13K rpm for 5 min
Put tubes in mag rack pipette off supernatant
Save 50 μl of one of the samples to use as an input lane
add 50 μl of 3X sample buffer +0.15M DTT to this boil for 5 min store -20°C
save as input -load 20ul of this on gel
Add 1ml of pre cleared lysate to each of the protein G –Antibody conjugates prepared day before
Put on rotating wheel in cold room for 2h
Put tubes on mag rack
Wash once with 1ml cold 0.5% triton x100 PBS
Put beads on rack remove liquid
Wash 3X more with 1ml cold 1XPBS
Suspend beads in 80 μl of 3X of 3X sample buffer +0.3MDTT boil 10 min
Put on mag rack
Transfer liquid to new tube
Load 15 μl on gel along with 20 μl of inputs
Gel run out on 10% SDS PAGE gel in MOPS buffer Transfered 100V 2hours 4 degrees nitrocellulose membrane blocked 5% milk PBST 1 hour incubated overnight with Cdc42EP1 antibody NBP1-88379 1:2000 in 5% milk PBST Washed 3X PBST Incubated with secondary anti rabbit HRP con light chain specific antibody 1:5000 (Jackson immunoresearch 211-032-171) in for 1hour 5% milk PBST Washed 3X PBST washed once 1X PBS ECL prime kit GE healthcare used for detection of chemilumincence
For siRNA blot two different siRNAs were transfected at 40nM, targeting cdc42ep1 or non targeting control siRNA cells were lysed after 72 hours post tranfection Protein lysates were lysed in 1.5X Lammeli sample buffer boiled at 100 degrees for 5 minutes 10ug of protein loaded on 10% SDS PAGE gel run in MOPS buffer I used the antibody at 1:2000 in 5% milk TBST incubation overnight 4 degrees antibody gives a band at -55kD that reduces in RNAi Membranes were reprobed with GAPDH antibody as a loading control
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.