Home » Caveolin-1 » Caveolin-1 Proteins » Caveolin-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Caveolin-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Caveolin-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Caveolin-1

Source: E. coli

Amino Acid Sequence: LIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CAV1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54737.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Caveolin-1 Recombinant Protein Antigen

  • CAV
  • CAV1
  • caveolae protein, 22kD
  • caveolin 1, caveolae protein, 22kDa
  • Caveolin1
  • Caveolin-1
  • cell growth-inhibiting protein 32
  • MSTP085
  • VIP21

Background

Caveolae are specialized domains of the plasma membrane that are implicated in the sequestration of a variety of lipid and protein molecules. It has been suggested that these important cellular organelles have a pivotal role in such diverse biochemical processes as lipid metabolism, growth regulation, signal transduction, and apoptosis. Caveolin interacts with and regulates heterotrimeric G-proteins. Currently, there are three members of the caveolin multigene family which are known to encode 21-24 kDa integral membrane proteins that comprise the major structural component of the caveolar membrane in vivo. Caveolin-2 protein is abundantly expressed in fibroblasts and differentiated adipocytes, smooth and skeletal muscle, and endothelial cells. The expression of caveolin-1 is similar to that of caveolin-2 while caveolin-3 expression appears to be limited to muscle tissue types.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caveolin-2 Antibody
NBP1-31116
Immunohistochemistry-Paraffin Caveolin-2 Antibody
Western Blot Caveolin-2 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-2 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Caveolin-3 Antibody
NB110-5029
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunohistochemistry-Paraffin Caveolin-3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Nanos3 Antibody -
BSA Free
NBP1-76919
Immunocytochemistry/ Immunofluorescence Nanos3 Antibody - BSA Free
Western Blot Nanos3 Antibody - BSA Free
Immunohistochemistry-Paraffin Nanos3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(676 Publications)
Species: Hu
Applications: ELISA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(793 Publications)
Species: Hu
Applications: BA
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Publications for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP) (0)

There are no publications for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP) (0)

There are no reviews for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caveolin-1 Products

Research Areas for Caveolin-1 Recombinant Protein Antigen (NBP2-54737PEP)

Find related products by research area.

Blogs on Caveolin-1

There are no specific blogs for Caveolin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: Caveolin-1 Antibody (7C8) [NB100-615] - An intracellular stain was performed on HeLa cells with Caveolin-1 Antibody (7C8) NB100-615 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Caveolin-1 Antibody (7C8)
NB100-615

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Caveolin-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CAV1