![Western Blot: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Analysis in human pancreas tissue.](http://images.novusbio.com/fullsize/Carboxypeptidase-A1-CPA1-Antibody-CL6607-Western-Blot-NBP2-76507-img0001.jpg "Western Blot: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Analysis in human pancreas tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clone | CL6607 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLESHGISYET |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CPA1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Carboxypeptidase A1/CPA1 Antibody (NBP2-76507)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPA1 |
![Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Staining of human tonsil shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/Carboxypeptidase-A1-CPA1-Antibody-CL6607-Immunohistochemistry-Paraffin-NBP2-76507-img0005.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Staining of human tonsil shows no positivity in lymphoid cells as expected.")
![Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Analysis in human pancreas and tonsil tissues. Corresponding CPA1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Carboxypeptidase-A1-CPA1-Antibody-CL6607-Immunohistochemistry-Paraffin-NBP2-76507-img0002.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Analysis in human pancreas and tonsil tissues. Corresponding CPA1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/Carboxypeptidase-A1-CPA1-Antibody-CL6607-Immunohistochemistry-Paraffin-NBP2-76507-img0003.jpg "Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (CL6607) [NBP2-76507] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]](https://images.novusbio.com/images2/Adrenomedullin_AF6108_Immunohistochemistry_9966.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
