Calcitonin R Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CALCR |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Theoretical MW |
57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Calcitonin R Antibody
Background
The Calcitonin Receptor inhibits bone resorption. This receptor is expressed during development and is involved in morphogenesis. Three alternatively spliced Calcitonin Receptor isoforms have been identified. In addition to binding calcitonin, the Calcitonin Receptor can complex with RAMP3 (receptor activity modifying protein) to bind amylin, which regulates pancreatic islet function and is involved in Type II diabetes. The Calcitonin Receptor has been reported in artery, blood, bone, brain, kidney, lung, placenta, prostate, skeletal muscle, and thyroid. ESTs have been isolated from bone, embryo, kidney, and melanocyte/uterus/fetal heart libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Publications for Calcitonin R Antibody (NBP1-88041) (0)
There are no publications for Calcitonin R Antibody (NBP1-88041).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Calcitonin R Antibody (NBP1-88041) (0)
There are no reviews for Calcitonin R Antibody (NBP1-88041).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Calcitonin R Antibody (NBP1-88041) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Calcitonin R Products
Research Areas for Calcitonin R Antibody (NBP1-88041)
Find related products by research area.
|
Blogs on Calcitonin R