Novus Biologicals products are now on bio-techne.com

BRD2 Recombinant Protein Antigen

Images

 
There are currently no images for BRD2 Recombinant Protein Antigen (NBP1-84310PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BRD2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BRD2.

Source: E. coli

Amino Acid Sequence: SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BRD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84310.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BRD2 Recombinant Protein Antigen

  • BRD2
  • bromodomain containing 2
  • bromodomain-containing 2
  • bromodomain-containing protein 2
  • D6S113E
  • female sterile homeotic-related gene 1
  • FSRG1
  • FSRG1FSH
  • KIAA9001FLJ31942
  • NAT
  • O27.1.1
  • Really interesting new gene 3 protein
  • RING3
  • RING3DKFZp686N0336
  • RNF3

Background

BRD2 (bromodomain-containing 2) is a nuclear mitogen-activated kinase that plays a role in transcription of cell-cycle-regulated genes (1). Alternate names for BRD2 include RING3, NAT, RNF3, FSRG1, D6S113E, FLJ31942, DKFZp686N0336, and KIAA9001 (2). BRD2 belongs to the BET (bromodomain/extra terminal domain) family of proteins which contain two tandem bromodomains (BDI and BDII) and an extra-terminal (ET) domain (1, 3). In mammals there are four BET paralogs (BRD2, BRD3, BRD4, and BRDT) which have a similar amino acid sequence, domain organization, and function (3). The bromodomain of BRD2 is a ~110 amino acids conserved sequence that forms 4 alpha-helices (alphaZ, alphaA, alphaB, and alphaC) and 2 loops (ZA and BC) that can bind to the acetylated lysine-12 residue of chromatin histone H4 and is required for epigenetic regulation of gene transcription (1-3). The ET is a conserved region of ~80 amino acids that recruits specific effector proteins (3). The theoretical molecular weight of BRD2 is 88 kDa but the observed band is typically ~110 kDa due to post-translational modifications. The coding region of the Brd2 gene contains 11 exons and covers over 6 kb of DNA (3). Furthermore, the gene maps to the major histocompatibility complex (MHC) class II region on chromosome 6p21.3 (2).

BRD2 and the other BET proteins have been implicated in a variety of diseases and pathologies. The BET proteins are known drivers of cancer through mutation and over-expression (1). Recently, in studies examining the role of Type 2 diabetes and obesity in breast cancer progression, the BET proteins have been shown to be critical regulators of metabolism and metastasis and are co-activators for the transcription of genes that encode pro-inflammatory cytokines in immune cells infiltrating the breast cancer microenvironment (1). Accordingly, knockdown of Brd2 in mice protected the animals from developing Type 2 diabetes and stopped the inflammatory response typically elicited by obesity (4). BRD2 is also highly expressed in the brain and the gene has been shown to play a role in juvenile myoclonic epilepsy, a common form of epilepsy that typically reveals itself during adolescence (5). In addition to the brain, BRD2 is highly expressed in the bone marrow and consequently its kinase activity has been shown to increase upon cellular proliferation and is significantly elevated in the peripheral blood lymphocytes of lymphoma patients (2, 3).

Research has been done to better understand protein interactions with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of the novel coronavirus disease 2019 (COVID-19), as possible targets for drug therapies. It was recently described that that the transmembrane envelope protein (E) of SARS-CoV-2 binds to both BRD2 and BRD4, suggesting that bromodomain inhibitors could be a potential drug target (6). More specifically, the bromodomain inhibitors could be relevant regarding the secondary immune-related consequences that arise from SARS-CoV-2 infection (6). Bromodomain inhibitors are currently the focus of multiple clinical trials as a potential therapeutic in cancer and pulmonary arterial hypertension (6).

References

1. Andrieu, G.P., Shafran, J.S., Deeney, J.T., Bharadwaj, K.R., Rangarajan, A., & Denis, G.V. (2018). BET proteins in abnormal metabolism, inflammation, and the breast cancer microenvironment. J Leukoc Biol. https://doi:10.1002/JLB.5RI0917-380RR

2. BRD2 bromodomain 2 (human), NCBI

3. Taniguchi, Y. (2016). The Bromodomain and Extra-Terminal Domain (BET) Family: Functional Anatomy of BET Paralogous Proteins. Int J Mol Sci. https://doi:10.3390/ijms17111849

4. Wang, F., Deeney, J.T., & Denis, G.V. (2013). Brd2 gene disruption causes "metabolically healthy" obesity: epigenetic and chromatin-based mechanisms that uncouple obesity from type 2 diabetes. Vitam Horm. https://doi:10.1016/B978-0-12-407766-9.00003-1

5. Gilsoul, M., Grisar, T., Delgado-Escueta, A.V., de Nijs, L., & Lakaye, B. (2019). Subtle Brain Developmental Abnormalities in the Pathogenesis of Juvenile Myoclonic Epilepsy. Front Cell Neurosci. https://doi:10.3389/fncel.2019.00433

6. Harrison, C. (2020). Drug researchers pursue new lines of attack against COVID-19. Nat Biotechnol. https://doi.org/10.1038/d41587-020-00013-z

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DSHBG0B
Species: Hu
Applications: ELISA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
291-G1
Species: Hu
Applications: BA
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NB300-506
Species: Am, Mu
Applications: ICC/IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
236-EG
Species: Hu
Applications: BA
MAB4169
Species: Hu
Applications: IHC, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00093659-P01
Species: Hu
Applications: ELISA, AP, PA, WB
664-LI
Species: Hu
Applications: BA
NBP1-84310PEP
Species: Hu
Applications: AC

Publications for BRD2 Recombinant Protein Antigen (NBP1-84310PEP) (0)

There are no publications for BRD2 Recombinant Protein Antigen (NBP1-84310PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRD2 Recombinant Protein Antigen (NBP1-84310PEP) (0)

There are no reviews for BRD2 Recombinant Protein Antigen (NBP1-84310PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BRD2 Recombinant Protein Antigen (NBP1-84310PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRD2 Products

Research Areas for BRD2 Recombinant Protein Antigen (NBP1-84310PEP)

Find related products by research area.

Blogs on BRD2

There are no specific blogs for BRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BRD2 Antibody
NBP1-30475

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BRD2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD2