Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Positive Control: Lane 1: 20ug Wild type mouse, left ventricle Lane 2: 20ug Transgenic mouse, treated with experimental drug , left ventricle Lane 3: 20ug ...read more
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Titration: 0.2-1 ug/ml, Positive Control: Human brain.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Heart Antibody Dilution: 1.0ug/ml.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Lung Antibody Dilution: 1.0ug/m.
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Fetal Muscle Antibody Dilution: 1.0ug/ml
Western Blot: beta-1 Adrenergic R/ADRB1 Antibody [NBP1-59007] - Human Adult Placenta Antibody Dilution: 1.0ug/ml.
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to ADRB1(adrenergic, beta-1-, receptor) The peptide sequence was selected from the middle region of ADRB1. Peptide sequence CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADRB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
51 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Rat reactivity reported in scientific literature (PMID: 30660767).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for beta-1 Adrenergic R/ADRB1 Antibody
ADRB1
ADRB1R
ADRB1RRHR
adrenergic, beta-1-, receptor
B1AR
beta-1 Adrenergic R
beta-1 adrenergic receptor
beta1 AdrenergicR
beta-1 AdrenergicR
Beta-1 adrenoceptor
Beta-1 adrenoreceptor
BETA1AR
Background
The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in ADRB1 gene have been shown to affect the resting heart rate and can be involved in heart failure.The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine. Specific polymorphisms in this gene have been shown to affect the resting heart rate and can be involved in heart failure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007) (0)
There are no reviews for beta-1 Adrenergic R/ADRB1 Antibody (NBP1-59007).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our beta-1 Adrenergic R/ADRB1 Antibody and receive a gift card or discount.