Novus Biologicals products are now on bio-techne.com

BCL7C Antibody (5F1)

Name: BCL7C Antibody (5F1)
Brand: Novus Biologicals
SKU: H00009274-M01
Price: 499 USD

Submit a Review

Images

(

Enlarge)

Sandwich ELISA: BCL7C Antibody (5F1) [H00009274-M01] - Detection limit for recombinant GST tagged BCL7C is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA
Clone	5F1
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BCL7C Antibody (5F1) Summary

Immunogen	BCL7C (NP_004756, 86 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLT
Specificity	BCL7C - B-cell CLL/lymphoma 7C
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	BCL7C
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Sandwich ELISA Western Blot 1:500
Application Notes	Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BCL7C Antibody (5F1)

B-cell CLL/lymphoma 7 protein family member C
B-cell CLL/lymphoma 7C

Background

This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of this gene has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Bcl 7A Antibody

NBP1-30941

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(46 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

ARID1B Antibody
(2F2)

H00057492-M02

Immunocytochemistry/ Immunofluorescence ARID1B Antibody (2F2)

(1 Review)

(5 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

ARID2 Antibody
(7311)

NBP2-43567

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, KO, WB

ARID1A Antibody

NBP1-88932

Immunohistochemistry-Paraffin ARID1A Antibody

(23 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

BCL7B Antibody
(6D2)

H00009275-M01

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, IHC, WB

IL-10 [Biotin]

DY417

(303 Publications)

Species: Mu

Applications: ELISA

SPARC Antibody
[Unconjugated]

AF942

Immunohistochemistry SPARC Antibody [Unconjugated]

Immunocytochemistry SPARC Antibody [Unconjugated]

(38 Publications)

Species: Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow, WB

BAF180/PB1 Antibody

NB100-79833

(1 Review)

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

BRD7 Antibody

NBP1-28727

(1 Publication)

Species: Hu, Mu

Applications: Flow, IHC, IHC-P, IP, WB

Neuro D4 Antibody

NBP2-13932

Immunohistochemistry-Paraffin Neuro D4 Antibody

(1 Review)

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

DPF2 Antibody -
BSA Free

NBP1-76512

Immunohistochemistry-Paraffin DPF2 Antibody - BSA Free

(1 Review)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

WHSC1 Antibody
(CL1063)

NBP2-52963

Immunohistochemistry-Paraffin WHSC1 Antibody (CL1063)

Immunocytochemistry/ Immunofluorescence WHSC1 Antibody (CL1063)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

FGFR3 Antibody
(136312) [Unconjugate ...

MAB7662

Flow Cytometry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)

Immunocytochemistry FGFR3 Antibody (136312) [Unconjugated] - (IIIc)

(1 Review)

(3 Publications)

Species: Hu

Applications: Flow, ICC, IHC, WB

BANF1 Antibody
(3F10-4G12)

H00008815-M01

Sandwich ELISA BANF1 Antibody (3F10-4G12)

(6 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

CDC25C Antibody
(461908) [Unconjugate

MAB4459

(2 Publications)

Species: Hu, Mu, Rt

Applications: WB

Peroxiredoxin 2
Antibody (4E10-2D2)

H00007001-M01

Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)

(1 Review)

(6 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB

GADD45G Antibody
(OTI2F12)

NBP2-45807

Immunohistochemistry GADD45G Antibody (OTI2F12)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

CD9 Antibody
(MEM-61) - BSA Free

NB500-327

(1 Review)

(16 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB

c-Maf Antibody -
BSA Free

NBP2-24551

(3 Reviews)

(2 Publications)

Species: Bv, Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Publications for BCL7C Antibody (H00009274-M01) (0)

There are no publications for BCL7C Antibody (H00009274-M01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BCL7C Antibody (H00009274-M01) (0)

There are no reviews for BCL7C Antibody (H00009274-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BCL7C Antibody (H00009274-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional BCL7C Products

Blogs on BCL7C

There are no specific blogs for BCL7C, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our BCL7C Antibody (5F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol	BCL7C
Entrez	9274(Human)
OMIM	605847(Human)
Uniprot	NP_004756(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

BCL7C Antibody (5F1)

Species Glossary

Images

Product Details

Order Details

BCL7C Antibody (5F1) Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for BCL7C Antibody (5F1)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for BCL7C Antibody (H00009274-M01) (0)

Reviews for BCL7C Antibody (H00009274-M01) (0)

Product General Protocols

Video Protocols

FAQs for BCL7C Antibody (H00009274-M01) (0)

Secondary Antibodies

Isotype Controls

Additional BCL7C Products

Blogs on BCL7C

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics