![Western Blot: UBTF Antibody [NBP1-82545] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/UBTF-Antibody-Western-Blot-NBP1-82545-img0025.jpg "Western Blot: UBTF Antibody [NBP1-82545] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK |
| Predicted Species | Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UBTF |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
-(01-ml)_NBP1-82545_9026.jpeg)
Enlarge |
reviewed by:
Ashwini Katre |
WB | Human | 07/24/2014 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBTF |
![Immunocytochemistry/Immunofluorescence: UBTF Antibody [NBP1-82545] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82545-img0024.jpg "Immunocytochemistry/Immunofluorescence: UBTF Antibody [NBP1-82545] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.")
![Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse brain shows strong positivity in neurons in the CA1 and granular cell layers in the hippocampus.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0032.jpg "Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse brain shows strong positivity in neurons in the CA1 and granular cell layers in the hippocampus.")
![Western Blot: UBTF Antibody [NBP1-82545] - Analysis in mouse cerebral cortex tissue.](http://images.novusbio.com/fullsize/UBTF-Antibody-Western-Blot-NBP1-82545-img0015.jpg "Western Blot: UBTF Antibody [NBP1-82545] - Analysis in mouse cerebral cortex tissue.")
![Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0026.jpg "Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0027.jpg "Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0028.jpg "Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human small intestine shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0029.jpg "Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human tonsil shows strong nuclear positivity in non-germinal center cells.")
![Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse basal forebrain shows moderate nuclear positivity in neurons in the caudate putamen.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0030.jpg "Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse basal forebrain shows moderate nuclear positivity in neurons in the caudate putamen.")
![Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse brain shows strong nuclear positivity in neurons in the cerebral cortex.](http://images.novusbio.com/fullsize/UBTF-Antibody-Immunohistochemistry-Paraffin-NBP1-82545-img0031.jpg "Immunohistochemistry: UBTF Antibody [NBP1-82545] - Staining of mouse brain shows strong nuclear positivity in neurons in the cerebral cortex.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/DATA_MMP3_DMP300_ELISA_767.jpg)
![N/A MMP-3 [HRP]](https://images.novusbio.com/images2/MMP-3_DMP300_ELISA_145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
-(01-ml)_NBP1-82545_9026.jpeg)