Home » ATP7A » ATP7A Proteins » ATP7A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ATP7A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ATP7A Recombinant Protein Antigen (NBP2-56307PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATP7A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP7A.

Source: E. coli

Amino Acid Sequence: LKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP7A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56307.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP7A Recombinant Protein Antigen

  • ATPase, Cu++ transporting, alpha polypeptide
  • Copper pump 1
  • copper-transporting ATPase 1
  • Cu++-transporting P-type ATPase
  • DSMAX
  • EC 3.6.3
  • EC 3.6.3.4
  • MC1
  • Menkes disease-associated protein
  • Menkes syndrome
  • MK
  • MNKFLJ17790
  • OHS
  • SMAX3

Background

ATP7A - ATPase, Cu++ transporting, alpha polypeptide (Menkes syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


Thrombopoietin/THPO [U
288-TPN/CF
Bioactivity Thrombopoietin/THPO [Unconjugated]
(12 Publications)
Species: Hu
Applications: BA
ATP7b Antibody -
BSA Free
NB100-360
Immunocytochemistry/ Immunofluorescence ATP7b Antibody - BSA Free
Western Blot ATP7b Antibody - BSA Free
Immunohistochemistry ATP7b Antibody - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Pleiotrophin/PTN
Antibody [Unconjugate ...
AF-252-PB
Immunohistochemistry Pleiotrophin/PTN Antibody [Unconjugated]
(21 Publications)
Species: Hu
Applications: IHC, WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(216 Publications)
Species: Hu
Applications: BA
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(201 Publications)
Species: Hu
Applications: BA
Thyroid Peroxidase
Antibody
NBP1-80670
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
Immunohistochemistry-Paraffin Thyroid Peroxidase Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
Integrin alpha
2b/CD41 Antibody (745 ...
MAB7616
Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
SLC31A1/CTR1
Antibody
NB100-402
Immunohistochemistry SLC31A1/CTR1 Antibody
Immunohistochemistry SLC31A1/CTR1 Antibody
Immunocytochemistry/ Immunofluorescence SLC31A1/CTR1 Antibody
(35 Publications)
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
ATOX1 Antibody
NBP1-06611
Immunocytochemistry/ Immunofluorescence ATOX1 Antibody
Western Blot ATOX1 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, WB
MVK Antibody (2C5)
H00004598-M02
Western Blot MVK Antibody (2C5)
Immunohistochemistry-Paraffin MVK Antibody (2C5)
Sandwich ELISA MVK Antibody (2C5)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
MNK1 Antibody
(2F12)
H00008569-M14
Western Blot MNK1 Antibody (2F12)
Western Blot MNK1 Antibody (2F12)
Western Blot MNK1 Antibody (2F12)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
ATP7A Recombinant
Protein Antigen
NBP2-56307PEP
ATP7A Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for ATP7A Recombinant Protein Antigen (NBP2-56307PEP) (0)

There are no publications for ATP7A Recombinant Protein Antigen (NBP2-56307PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP7A Recombinant Protein Antigen (NBP2-56307PEP) (0)

There are no reviews for ATP7A Recombinant Protein Antigen (NBP2-56307PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP7A Recombinant Protein Antigen (NBP2-56307PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP7A Products

Array NBP2-56307PEP

Research Areas for ATP7A Recombinant Protein Antigen (NBP2-56307PEP)

Find related products by research area.

Blogs on ATP7A

There are no specific blogs for ATP7A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP7A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ATP7A