Novus Biologicals products are now on bio-techne.com

ATP6V1H Recombinant Protein Antigen

Images

 
There are currently no images for ATP6V1H Protein (NBP1-85668PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ATP6V1H Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V1H.

Source: E. coli

Amino Acid Sequence: PQVLAVAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWEYLGKQLQSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP6V1H
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85668.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATP6V1H Recombinant Protein Antigen

  • ATPase, H+ transporting, lysosomal 50/57kD, V1 subunit H
  • ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H
  • CGI-11
  • MSTP042
  • NBP1
  • Nef-binding protein 1
  • Protein VMA13 homolog
  • SFD
  • SFDalpha
  • SFDbeta
  • vacuolar ATP synthase subunit H
  • vacuolar ATPase subunit H
  • vacuolar proton pump H subunit
  • Vacuolar proton pump subunit H
  • Vacuolar proton pump subunit SFD
  • V-ATPase 50/57 kDa subunits
  • V-ATPase H subunit
  • V-ATPase subunit H
  • VMA13
  • V-type proton ATPase subunit H

Background

ATP6V1H, also known as V-type proton ATPase subunit H, is a 483 amino acid protein that is a subunit of the V1 complex, which is responsible for acidifying eukaryotic cells in intracellular organelles. Studies on this protein have shown a relationship with the following disorders and diseases, osteopetrosis, carcinoma, cholera, colon carcinoma, arthritis, rheumatoid arthritis, neuronitis, tuberculosis, and immunodeficiency. The ATP6V1H protein has also shown an interaction with ATP6V1D, ATP6V1F, ATP6V1B2, ATP6V1E1, and ETHE1 in the oxidative phosphorylation, metabolic, phagosome, lysosome, insulin receptor recycline, and Iron uptake and transport pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

973-TM
Species: Hu
Applications: InhibAct
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
H00051531-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP2-24727
Species: Ca, Hu, Mu
Applications: ICC/IF, WB
NBP2-00834
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-19491
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB

Publications for ATP6V1H Protein (NBP1-85668PEP) (0)

There are no publications for ATP6V1H Protein (NBP1-85668PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP6V1H Protein (NBP1-85668PEP) (0)

There are no reviews for ATP6V1H Protein (NBP1-85668PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATP6V1H Protein (NBP1-85668PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATP6V1H Products

Blogs on ATP6V1H

There are no specific blogs for ATP6V1H, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ATP6V1H Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP6V1H