![Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Arrestin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-68802-img0005.jpg "Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARR3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Recommended conditions for IHC,Retrieval method: HIER pH6 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Arrestin 3 Antibody (NBP2-68802)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARR3 |
![Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human eye, retina shows strong cytoplasmic positivity in cones.](http://images.novusbio.com/fullsize/Arrestin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-68802-img0001.jpg "Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human eye, retina shows strong cytoplasmic positivity in cones.")
![Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human liver shows no psotivitiy in hepatocytes as expected.](http://images.novusbio.com/fullsize/Arrestin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-68802-img0003.jpg "Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human liver shows no psotivitiy in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human tonsil shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/Arrestin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-68802-img0004.jpg "Immunohistochemistry-Paraffin: Arrestin 3 Antibody [NBP2-68802] - Staining of human tonsil shows no positivity in lymphoid cells as expected.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Western Blot CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Western_Blot_17043.jpg)
![Simple Western CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Immunohistochemistry_17641.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![N/A CD46 Antibody (344519) [Unconjugated]](https://images.novusbio.com/images/antibody/mab2005_human-cd46-mab-clone-344519-209202413163..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")