Novus Biologicals products are now on bio-techne.com

ARID1A Recombinant Protein Antigen

Images

 
There are currently no images for ARID1A Recombinant Protein Antigen (NBP2-61623PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ARID1A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARID1A.

Source: E. coli

Amino Acid Sequence: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ARID1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-61623.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARID1A Recombinant Protein Antigen

  • ARID domain-containing protein 1A
  • AT rich interactive domain 1A (SWI- like)
  • AT rich interactive domain 1A (SWI-like)
  • AT-rich interactive domain-containing protein 1A
  • B120SWI-like protein
  • BAF250a
  • BAF250SWI/SNF complex protein p270
  • BM029
  • brain protein 120
  • BRG1-associated factor 250
  • BRG1-associated factor 250a
  • C10rf4
  • C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1
  • chromatin remodeling factor p250
  • hELD
  • hOSA1
  • matrix associated, actin dependent regulator of chromatin
  • Osa homolog 1
  • OSA1 nuclear protein
  • OSA1
  • P270
  • SMARCF1
  • subfamily f, member 1

Background

ARID1A encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain ARID1A genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
H00057492-M02
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-13283
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00006598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00008815-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-79833
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-90017
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, Simple Western, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-20415
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP1-32870
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB

Publications for ARID1A Recombinant Protein Antigen (NBP2-61623PEP) (0)

There are no publications for ARID1A Recombinant Protein Antigen (NBP2-61623PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARID1A Recombinant Protein Antigen (NBP2-61623PEP) (0)

There are no reviews for ARID1A Recombinant Protein Antigen (NBP2-61623PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARID1A Recombinant Protein Antigen (NBP2-61623PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARID1A Products

Research Areas for ARID1A Recombinant Protein Antigen (NBP2-61623PEP)

Find related products by research area.

Blogs on ARID1A

There are no specific blogs for ARID1A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARID1A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1A