Home » ARH » ARH Proteins » ARH Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ARH Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ARH Recombinant Protein Antigen (NBP2-48959PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ARH Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARH.

Source: E. coli

Amino Acid Sequence: MAQAVTLTVAQAFKVAFEFWQVSKEEKEKRDKASQEGGDVLGARQDCTPSLKSLVATGNLLDL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LDLRAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48959.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARH Recombinant Protein Antigen

  • ARH1
  • ARH2
  • ARHAutosomal recessive hypercholesterolemia protein
  • DKFZp586D0624
  • FHCB1ARH1
  • FHCB2LDL receptor adaptor protein
  • low density lipoprotein receptor adapter protein 1
  • low density lipoprotein receptor adaptor protein 1
  • MGC34705

Background

ARH is encoded by this gene is a cytosolic protein which contains a phosphotyrosine binding (PTD) domain. The PTD domain has been found to interact with the cytoplasmic tail of the LDL receptor. Mutations in this gene lead to LDL receptor malfunction and cause the disorder autosomal recessive hypercholesterolaemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

LDLR Antibody
[Unconjugated]
AF2255
Immunohistochemistry LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
(47 Publications)
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
PrPC Antibody
NB100-56605
Western Blot PrPC Antibody
Species: Av, Bv, Sh
Applications: WB
Fibroblast
Activation Protein al ...
DPC900
N/A Fibroblast Activation Protein alpha/FAP [HRP]
N/A Fibroblast Activation Protein alpha/FAP [HRP]
(51 Publications)
Species: Hu
Applications: ELISA
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(156 Publications)
Species: Hu
Applications: ELISA
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
CARD14 Antibody -
Azide and BSA Free
NBP2-92873
Western Blot CARD14 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Peroxiredoxin 2
Antibody (4E10-2D2)
H00007001-M01
ELISA Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
Western Blot Peroxiredoxin 2 Antibody (4E10-2D2)
(1 Review)
(6 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
AP2 alpha Antibody
(3B5)
NB100-74359
Western Blot AP2 alpha Antibody (3B5)
Immunohistochemistry-Frozen AP2 alpha Antibody (3B5)
Western Blot AP2 alpha Antibody (3B5)
(1 Review)
(3 Publications)
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
C4 binding protein
A Antibody
NBP1-88262
Western Blot C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Immunohistochemistry-Paraffin C4 binding protein A Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(25 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
DAB2 Antibody
AF8064
Western Blot DAB2 Antibody
Immunocytochemistry DAB2 Antibody
Immunohistochemistry DAB2 Antibody
(2 Publications)
Species: Hu
Applications: ICC, IHC, WB
ADPRHL2 Antibody
NBP1-88835
Immunocytochemistry/ Immunofluorescence ADPRHL2 Antibody
Immunohistochemistry-Paraffin ADPRHL2 Antibody
Immunohistochemistry-Paraffin ADPRHL2 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dystonin Antibody
NBP1-89946
Immunocytochemistry/ Immunofluorescence Dystonin Antibody
Immunohistochemistry-Paraffin Dystonin Antibody
Immunohistochemistry-Paraffin Dystonin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Apolipoprotein
B/ApoB Antibody (3697 ...
MAB4124
Immunohistochemistry Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
Western Blot Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
Simple Western Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]
(7 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Fumarase Antibody
NBP1-31336
Western Blot Fumarase Antibody
Western Blot Fumarase Antibody
Immunocytochemistry/ Immunofluorescence Fumarase Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AgRP/ART [HRP]
DAGR00
N/A AgRP/ART [HRP]
N/A AgRP/ART [HRP]
N/A AgRP/ART [HRP]
(3 Publications)
Species: Hu
Applications: ELISA
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB

Publications for ARH Recombinant Protein Antigen (NBP2-48959PEP) (0)

There are no publications for ARH Recombinant Protein Antigen (NBP2-48959PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARH Recombinant Protein Antigen (NBP2-48959PEP) (0)

There are no reviews for ARH Recombinant Protein Antigen (NBP2-48959PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ARH Recombinant Protein Antigen (NBP2-48959PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARH Products

Array NBP2-48959PEP

Research Areas for ARH Recombinant Protein Antigen (NBP2-48959PEP)

Find related products by research area.

Blogs on ARH

There are no specific blogs for ARH, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ARH Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LDLRAP1