![Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Confocal imaging of paraffin-embedded Mouse brain tissue using Arginyl tRNA synthetase Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.](http://images.novusbio.com/fullsize/nbp3-33518_rabbit-arginyl-trna-synthetase-mab-4y1h4-31120251704746.jpg "Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Confocal imaging of paraffin-embedded Mouse brain tissue using Arginyl tRNA synthetase Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 4Y1H4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human Arginyl tRNA synthetase (NP_002878.2). Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSSPNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGDWGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRFDTEEEFKKRAYQCVVLLQGK |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RARS1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 75 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RARS1 |
![Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Confocal imaging of paraffin-embedded Mouse brain tissue using Arginyl tRNA synthetase Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.](http://images.novusbio.com/fullsize/nbp3-33518_rabbit-arginyl-trna-synthetase-mab-4y1h4-31120251704780.jpg "Immunocytochemistry/ Immunofluorescence: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Confocal imaging of paraffin-embedded Mouse brain tissue using Arginyl tRNA synthetase Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.")
![Western Blot: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Western Blot analysis of lysates from 293T cells using Arginyl tRNA synthetase Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp3-33518_rabbit-arginyl-trna-synthetase-mab-4y1h4-31120251659364.jpg "Western Blot: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Western Blot analysis of lysates from 293T cells using Arginyl tRNA synthetase Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.")
![Immunohistochemistry: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Arginyl tRNA synthetase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-33518_rabbit-arginyl-trna-synthetase-mab-4y1h4-3112025173136.jpg "Immunohistochemistry: Arginyl tRNA synthetase Antibody (4Y1H4) [NBP3-33518] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Arginyl tRNA synthetase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.")
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![SCF/c-kit Ligand [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "SCF/c-kit Ligand [Unconjugated]")
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")