![Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TUFM antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Western-Blot-NBP2-36751-img0014.jpg "Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-TUFM antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KD |
| Clone | CL2242 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKPGSI |
| Epitope | RDLEKPFLLPVEAVY |
| Predicted Species | Mouse (95%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TUFM |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation reported in scientific literature (PMID:31801089). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
| Publication using NBP2-36751 | Applications | Species |
|---|---|---|
| Wall CE, Rose CM, Adrian M PPEF2 Opposes PINK1-Mediated Mitochondrial Quality Control by Dephosphorylating Ubiquitin Cell Rep 2019-12-03 [PMID: 31801089] (KD, IP, WB, Rat, Human) | KD, IP, WB | Rat, Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in MCF7 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunocytochemistry-Immunofluorescence-NBP2-36751-img0016.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in MCF7 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunohistochemistry-Paraffin-NBP2-36751-img0020.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts and in Leydig cells.")
![Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Western-Blot-NBP2-36751-img0007.jpg "Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Lane 1: Marker [kDa]. Lane 2: Human cell line U-251 MG")
![Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Lane 1: Marker [kDa], Lane 2: Human cell line HeLa cytoplasmic fraction , Lane 3: Human cell line HeLa membrane fraction , Lane 4: Human cell line HeLa nuclear fraction , Lane 5: Human cell line HeLa chromatin fraction , Lane 6: Human cell line HeLa cytos](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Western-Blot-NBP2-36751-img0013.jpg "Western Blot: TUFM Antibody (CL2242) [NBP2-36751] - Lane 1: Marker [kDa], Lane 2: Human cell line HeLa cytoplasmic fraction , Lane 3: Human cell line HeLa membrane fraction , Lane 4: Human cell line HeLa nuclear fraction , Lane 5: Human cell line HeLa chromatin fraction , Lane 6: Human cell line HeLa cytos")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in HeLa cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunocytochemistry-Immunofluorescence-NBP2-36751-img0008.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in HeLa cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in U2OS cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunocytochemistry-Immunofluorescence-NBP2-36751-img0011.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in U2OS cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in U251 cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunocytochemistry-Immunofluorescence-NBP2-36751-img0012.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in U251 cell line showing distinct mitochondrial staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in A431 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunocytochemistry-Immunofluorescence-NBP2-36751-img0015.jpg "Immunocytochemistry/Immunofluorescence: TUFM Antibody (CL2242) [NBP2-36751] - Staining in A431 cell line with Anti-TUFM monoclonal antibody, showing distinct mitochondrial staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunohistochemistry-Paraffin-NBP2-36751-img0017.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunohistochemistry-Paraffin-NBP2-36751-img0018.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and moderate staining in glomerular cells.](http://images.novusbio.com/fullsize/TUFM-Antibody-CL2242-Immunohistochemistry-Paraffin-NBP2-36751-img0019.jpg "Immunohistochemistry-Paraffin: TUFM Antibody (CL2242) [NBP2-36751] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and moderate staining in glomerular cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")