![Western Blot: ARF4 Antibody [NBP2-86578] - Host: Rabbit. Target Name: ARF4. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/ARF4-Antibody-Western-Blot-NBP2-86578-img0001.jpg "Western Blot: ARF4 Antibody [NBP2-86578] - Host: Rabbit. Target Name: ARF4. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ARF4. Peptide sequence: DELQDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARF4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunocytochemistry__Immunofluorescence_21634.jpg)
![Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]](https://images.novusbio.com/images2/FosB_AF2214_Immunohistochemistry_9938.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ARF4 Antibody (NBP2-86578)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ARF4 |
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")