I am looking for antibodies against human ARF4 and ARF5 and I need to be able to distinguish between the two proteins. Do you have antibodies specific for each protein that won't cross react with the other protein?

Name: ARF5 Antibody (1B4)
Brand: Novus Biologicals
SKU: H00000381-M01
Price: 519 USD

Question

Accepted Answer

I checked the sequence similarity between ARF4 and ARF5, and there is very high homology between the two proteins. We have not specifically tested our antibodies for cross-reactivity between the two, but I think it's likely that they will.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, Rt, Ba, CaSpecies Glossary
Applications	WB, ELISA, ICC/IF
Clone	1B4
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR
Specificity	ARF5 - ADP-ribosylation factor 5
Isotype	IgG1 Kappa
Clonality	Monoclonal
Host	Mouse
Gene	ARF5
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Publications using H00000381-M01	Applications	Species
Racha Fayad, Monserrat Vázquez Rojas, Mariagrazia Partisani, Pascal Finetti, Shiraz Dib, Sophie Abelanet, Virginie Virolle, Anne Farina, Olivier Cabaud, Marc Lopez, Daniel Birnbaum, François Bertucci, Michel Franco, Frédéric Luton EFA6B regulates a stop signal for collective invasion in breast cancer Nature Communications 2021-04-13 [PMID: 33850160]
Nacke M, Sandilands E, Nikolatou K et al. An ARF GTPase module promoting invasion and metastasis through regulating phosphoinositide metabolism Nature communications 2021-03-12 [PMID: 33712589] (WB, Human)	WB	Human
Lixin L, Sulin Z, Yirui W et al. BIG1 Controls Macrophage Pro-Inflammatory Responses Through ARF3-mediated PI(4,5)P2 Synthesis. Cell Death Dis. 2020-05-15 [PMID: 32415087]
Ignashkova TI, Gendarme M, Peschk K et al. Cell survival and protein secretion associated with Golgi integrity in response to Golgi stress-inducing agents. Traffic 2017-05-09 [PMID: 28485883]
Wesolowski J, Weber MM, Nawrotek A et al. Chlamydia Hijacks ARF GTPases To Coordinate Microtubule Posttranslational Modifications and Golgi Complex Positioning. MBio 2017-05-02 [PMID: 28465429]
Hanai A, Ohgi M, Yagi C et al. Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis. J Biochem. 2015-09-01 [PMID: 26330566]
Munzberg C, Hohn K, Krndija D et al. IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells. J Cell Mol Med. 2015-03-08 [PMID: 25754106]
Reiling JH, Olive AJ, Sanyal S et al. A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens. Nat Cell Biol. 2013-12-01 [PMID: 24185178]
Nakai W, Kondo Y, Saitoh A et al. ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus. Mol Biol Cell. 2013-06-19 [PMID: 23783033]
Takashima K, Saitoh A, Hirose S et al. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Cell Struct Funct. 2012-06-01 [PMID: 22185782]
Kudelko M, Brault JB, Kwok K et al. Class II ADP-Ribosylation factors are required for efficient secretion of dengue viruses. J Biol Chem. 2011-11-21 [PMID: 22105072]
Puxeddu E, Uhart M, Li CC et al. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 BIG2 effect on ARF1 activity. Proc Natl Acad Sci U S A;106(15):6158-63. 2009-04-14 [PMID: 19332778]
Klein S, Partisani M, Franco M et al. EFA6 Facilitates the Assembly of the Tight Junction by Coordinating an Arf6-dependent -independent Pathway. J Biol Chem;283(44):30129-30138. 2008-01-01 [PMID: 18779331]
Islam A, Shen X, Hiroi T et al. The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles. J Biol Chem;282(13):9591-9. 2007-03-30 [PMID: 17276987]
Show All 14 Publications. Collapse Publications.

ARF5 Antibody (1B4)

Species Glossary

Images

Product Details

Order Details

ARF5 Antibody (1B4) Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for ARF5 Antibody (1B4)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ARF5 Antibody (H00000381-M01)(14)

Reviews for ARF5 Antibody (H00000381-M01) (0)

Product General Protocols

Video Protocols

FAQs for ARF5 Antibody (H00000381-M01). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional ARF5 Products

Research Areas for ARF5 Antibody (H00000381-M01)

Blogs on ARF5

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	ARF5
Entrez	381(Human)
OMIM	103188(Human)
Uniprot	AAH03043(Human)