![Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Analysis in human kidney and pancreas tissues. Corresponding Aquaporin-6 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aquaporin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-90119-img0006.jpg "Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Analysis in human kidney and pancreas tissues. Corresponding Aquaporin-6 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AQP6 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Aquaporin-6 antibody validated for IHC-P from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Santhosh Sivajothi |
IHC-P | Human | 05/22/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AQP6 |
![Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human tonsil shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/Aquaporin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-90119-img0009.jpg "Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human tonsil shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/Aquaporin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-90119-img0002.jpg "Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes. Image from verified customer review.](http://images.novusbio.com/fullsize/Aquaporin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-90119-img0005.jpg "Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Human kidney tissue. Heat mediated antigen retrieval was performed by heating in citrate buffer (pH6) at 95C for 20 minutes. Image from verified customer review.")
![Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Aquaporin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-90119-img0007.jpg "Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human stomach shows moderate to strong cytoplasmic positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/Aquaporin-6-Antibody-Immunohistochemistry-Paraffin-NBP1-90119-img0008.jpg "Immunohistochemistry-Paraffin: Aquaporin-6 Antibody [NBP1-90119] - Staining of human stomach shows moderate to strong cytoplasmic positivity in a subset of glandular cells.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221341.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221447.png)
![N/A CREB [p Ser133] [Biotin]](https://images.novusbio.com/images2/dyc2510-2_human-mouse-rat-phospho-creb-s133-duoset-ic-elisa-2-plate-712021221551.png)
![Flow Cytometry CD1b Antibody (737249) [Unconjugated]](https://images.novusbio.com/images2/CD1b_MAB7446_Flow_Cytometry_12185.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
