![SDS-Page: Recombinant Human APAF-1 Protein [H00000317-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/Recombinant-Human-APAF-1-Protein-SDS-Page-H00000317-Q01-img0001.jpg "SDS-Page: Recombinant Human APAF-1 Protein [H00000317-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1138-1237 of Human APAF-1 Source: Wheat Germ (in vitro) Amino Acid Sequence: GEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIKWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | APAF1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Theoretical MW | 36.85 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for APAF-1 Partial Recombinant Protein (H00000317-Q01)Find related products by research area.
|
|
Caspase 9 - an important apoptosis marker Caspases are essential mediators of programmed cell death and are needed for both the induction of apoptosis as well as for aiding the degradation of cellular structures. Initiator caspases (such as Caspase-9) sense and respond to various signals i... Read full blog post. |
|
Heat Shock Proteins: An Overview Heat Shock Proteins (HSPs) are a ubiquitous group of molecular chaperone proteins that have evolved unique mechanisms, within their host cells, to facilitate survival in hostile environments such as heat, oxidative (hypoxia), pH and cold. Under permis... Read full blog post. |
|
The Role of the Caspase 3 Antibody in Apoptosis Research The caspases are a group of cysteine protease enzymes essential to apoptosis, inflammation and necrosis. Caspase 3 has been identified as one of the key mediators of apoptosis.Human caspases form three distinct groups: cytokine activators, which are... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | APAF1 |
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Western_Blot_5909.jpg)
![Immunocytochemistry Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Immunocytochemistry__Immunofluorescence_22092.jpg)
![Knockout Validated Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Knockout_Validated_22544.jpg)
![Western Blot XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Western_Blot_5911.jpg)
![Simple Western XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Simple_Western_16640.jpg)
![Knockout Validated XIAP Antibody [Unconjugated]](https://images.novusbio.com/images2/XIAP_AF8221_Knockout_Validated_22488.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Simple Western BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Simple_Western_16992.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_22585.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_9663.jpg)
![Western Blot AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/AIF_AF1457_Western_Blot_5113.jpg)
![Simple Western AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/16334.jpg)
![Knockout Validated AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/AIF_AF1457_Knockout_Validated_22786.jpg)
