Aminopeptidase A/ENPEP Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ENPEP |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Aminopeptidase A/ENPEP Antibody
Background
Aminopeptidase A is a zinc-dependent metallopeptidase that selectively cleaves N-terminal Glu, or Asp residues from peptides. In mice, it is expressed on early B cells and on a subset of thymic cortical epithelial cells, but not on mature lymphocytes. Additionally, it is expressed on endothelial cells, intestinal epithelium, proximal renal tubules, and other non-hemopoietic tissues. In humans, angiotensin II is the the best-defined biologically active substrate of APA. Although its role in the immune response is still uncertain, its expression on renal cell carcinoma has been the focus of some cancer research studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC
Publications for Aminopeptidase A/ENPEP Antibody (NBP1-85774) (0)
There are no publications for Aminopeptidase A/ENPEP Antibody (NBP1-85774).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aminopeptidase A/ENPEP Antibody (NBP1-85774) (0)
There are no reviews for Aminopeptidase A/ENPEP Antibody (NBP1-85774).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Aminopeptidase A/ENPEP Antibody (NBP1-85774) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Aminopeptidase A/ENPEP Products
Research Areas for Aminopeptidase A/ENPEP Antibody (NBP1-85774)
Find related products by research area.
|
Blogs on Aminopeptidase A/ENPEP