Novus Biologicals products are now on bio-techne.com

AlphaA Crystallin/CRYAA Recombinant Protein Antigen

Images

 
There are currently no images for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

AlphaA Crystallin/CRYAA Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AlphaA Crystallin/CRYAA.

Source: E. coli

Amino Acid Sequence: PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRYAA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68634.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AlphaA Crystallin/CRYAA Recombinant Protein Antigen

  • AlphaA Crystallin
  • CRYA1
  • CRYA1crystallin, alpha-1
  • CRYAA
  • crystallin, alpha A
  • Heat shock protein beta-4
  • HSPB4
  • HSPB4alpha-crystallin A chain
  • human alphaA-crystallin (CRYA1), 10HspB4

Background

Lens proteins consist almost entirely of crystallins (about 95%). Crystallins are also found vertebrate skeletal muscle tissue. In the lens, their structural function is to assist in maintaining the proper refractive index of the lens. The mammalian lens contains 3 major classes of crystallins: alpha, beta, and gamma. Alpha-crystallin is the largest of the crystallins and is composed of 2 primary gene products--alpha-A and alpha-B. There are at least 5 different proteins comprising the beta-crystallins. The gamma-crystallins are monomeric, but there are at least 5 gamma crystallins identified in bovine and rat lens. Alpha-Crystallin comprises 40% of total lens protein composition. In addition to maintaining proper refractive index, it also functions in a chaperone like manner by preventing the formation of aggregates possibly leading to cataract formation. It is believed that the phosphorylated states of the alpha-crystallin occur in response to cellular stress and may serve a structural control function and play a role in protein maintenance. Alpha-B crystallin has been linked to Alexander®s disease where it accumulates in brain cells of those afflicted.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00001415-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-03301
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-68799
Species: Hu
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-33010
Species: Mu
Applications: ICC/IF, WB
NBP2-68576
Species: Hu, Mu
Applications: IHC, IHC-P
NBP3-12222
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF8150
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-58660
Species: Hu
Applications: IHC, IHC-P
664-LI
Species: Hu
Applications: BA
MAB4987
Species: Hu, Mu, Rt
Applications: WB
MAB5695
Species: Hu, Mu
Applications: WB
NBP1-32741
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001417-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-68634PEP
Species: Hu
Applications: AC

Publications for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP) (0)

There are no publications for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP) (0)

There are no reviews for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AlphaA Crystallin/CRYAA Products

Research Areas for AlphaA Crystallin/CRYAA Recombinant Protein Antigen (NBP2-68634PEP)

Find related products by research area.

Blogs on AlphaA Crystallin/CRYAA

There are no specific blogs for AlphaA Crystallin/CRYAA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AlphaA Crystallin/CRYAA Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYAA