Home » alpha-Methylacyl-CoA Racemase/AMACR » alpha-Methylacyl-CoA Racemase/AMACR Antibodies » alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362)
Novus Biologicals products are now on bio-techne.com

alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Analysis in human cell line CACO-2.
Western Blot: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Analysis in human cell line CACO-2.
Orthogonal Strategies: Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Analysis in human kidney and skeletal muscle tissues using NBP2-88931 antibody. ...read more
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Staining of human liver cancer shows strong granular cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) [NBP2-88931] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clone
CL9362
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: APFYTTYRTADGEFMAVGAIEPQFYELLIKGLGLKSDELPNQMSMDDWPEMKKKFADVFAKKTKAEWCQIFDGTDACVTPVLTF
Epitope
ADVFAKKTKAEWCQI
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
AMACR
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362)

  • 2-methylacyl-CoA racemase
  • alpha-Methylacyl-CoA Racemase
  • alphaMethylacylCoARacemase
  • AMACR
  • AMACRD
  • CBAS4
  • EC 5.1.99.4
  • RACE
  • RM

Background

AMACR (alpha-methylacyl-CoA racemase) has been recently described as prostate cancer-specific gene that encodes a protein involved in the beta-oxidation of branched chain fatty acids. Expression of AMACR protein is found in prostatic adenocarcinoma but not in benign prostatic tissue. It stains premalignant lesions of prostate: high-grade prostatic intraepithelial neoplasia (PIN) and atypical adenomatous hyperplasia. AMACR can be used as a positive marker for PIN. Defects in AMACR are the cause of congenital bile acid synthesis defect type 4 (CBAS4); also known as cholestasis, intrahepatic, with defective conversion of trihydroxycoprostanic acid to cholic acid or trihydroxycoprostanic acid in bile. Clinical features include neonatal jaundice, intrahepatic cholestasis, bile duct deficiency and absence of cholic acid from bile.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
CKAP4/p63 Antibody
[Unconjugated]
AF7355
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
Western Blot CKAP4/p63 Antibody [Unconjugated]
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(97 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, In vivo, KO, Simple Western, WB
UVRAG Antibody
NBP1-18885
Immunohistochemistry-Paraffin UVRAG Antibody
Western Blot UVRAG Antibody
Western Blot UVRAG Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
PLAG1 Antibody
(3B7)
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7)
Immunohistochemistry PLAG1 Antibody (3B7)
ELISA PLAG1 Antibody (3B7)
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB

Puromycin-sensitive am ...
NBP2-13669
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
PRB1 Antibody
NBP3-41252
PRB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MUC1 Antibody -
BSA Free
NBP1-60046
Knockout Validated MUC1 Antibody - BSA Free
Knockout Validated MUC1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence MUC1 Antibody - BSA Free
(8 Publications)
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(70 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP2-88931) (0)

There are no publications for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP2-88931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP2-88931) (0)

There are no reviews for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP2-88931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP2-88931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha-Methylacyl-CoA Racemase/AMACR Products

Research Areas for alpha-Methylacyl-CoA Racemase/AMACR Antibody (NBP2-88931)

Find related products by research area.

Blogs on alpha-Methylacyl-CoA Racemase/AMACR

There are no specific blogs for alpha-Methylacyl-CoA Racemase/AMACR, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007
SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.
Mouse IgG1 Isotype Control (MG1)
NBP1-97005-0.5mg

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha-Methylacyl-CoA Racemase/AMACR Antibody (CL9362) and receive a gift card or discount.


Bioinformatics

Gene Symbol AMACR