![Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining in human thyroid gland and skeletal muscle tissues using anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49332-img0007.jpg "Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining in human thyroid gland and skeletal muscle tissues using anti-GANAB antibody. Corresponding GANAB RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GRDENSVELTMAEGPYKIILTARPFRLDLLEDRSLLLSVNARGLLEFEHQRAPRVSQGSKDPAEGDGAQPEETPRDG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GANAB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GANAB |
![Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human cerebral cortex, colon, skeletal muscle and thyroid gland using Anti-GANAB antibody NBP2-49332 (A) shows similar protein distribution across tissues to independent antibody NBP1-89806 (B).](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49332-img0008.jpg "Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human cerebral cortex, colon, skeletal muscle and thyroid gland using Anti-GANAB antibody NBP2-49332 (A) shows similar protein distribution across tissues to independent antibody NBP1-89806 (B).")
![Immunocytochemistry/Immunofluorescence: alpha Glucosidase 2 Antibody [NBP2-49332] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49332-img0004.jpg "Immunocytochemistry/Immunofluorescence: alpha Glucosidase 2 Antibody [NBP2-49332] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.")
![Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human colon.](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49332-img0010.jpg "Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human colon.")
![Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49332-img0005.jpg "Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human thyroid gland shows high expression.](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49332-img0006.jpg "Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human thyroid gland shows high expression.")
![Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/alpha-Glucosidase-2-Antibody-Immunohistochemistry-Paraffin-NBP2-49332-img0009.jpg "Immunohistochemistry-Paraffin: alpha Glucosidase 2 Antibody [NBP2-49332] - Staining of human cerebral cortex.")
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images2/Leptin_R_AF497_Immunohistochemistry_6850.jpg)
![Western Blot Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-41202410481130.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-immunohistochemistry-251120248493..jpg)
![N/A CXCL4/PF4 [Biotin]](https://images.novusbio.com/images2/DATA_CXCL4_DY795_ELISA_2231.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")