Home » alpha 2-Macroglobulin » alpha 2-Macroglobulin Proteins » alpha 2-Macroglobulin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

alpha 2-Macroglobulin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

alpha 2-Macroglobulin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human A2M.

Source: E. coli

Amino Acid Sequence: SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
A2M
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85491.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alpha 2-Macroglobulin Recombinant Protein Antigen

  • A2M
  • alpha 2Macroglobulin
  • alpha 2-Macroglobulin
  • alpha-2-M
  • alpha-2-macroglobulin
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
  • CPAMD5
  • CPAMD5DKFZp779B086
  • FWP007
  • S863-7

Background

Alpha 2 macroglobulin is a serum protein which is mainly synthesised in the liver. It functions as a broad range irreversible proteinase inhibitor that forms a "trap" around most proteases. Alpha 2 macroglobulin is is a tetrameric molecule, and with a molecular weight of 720 kDa, it so large a molecule that it tends to remain intravascular. Following conformational change, the protinase is deposited within a central cavity where it is still active but prevented from further contact with its substrate. Removal of the complex is mediated by the generation of recognition sites which react with receptors on a variety of cells including macrophages and liver cells. Alpha 2 macroglobulin is localized on the surface of peripheral blood lymphocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular) Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Western Blot Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
Flow Cytometry Apolipoprotein E/ApoE Antibody (WUE-4) - BSA Free
(2 Reviews)
(36 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Holo-Transferrin
[Unconjugated]
2914-HT
Holo-Transferrin [Unconjugated]
(45 Publications)
Species: Hu
Applications: BA
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Serpin
C1/Antithrombin-III A ...
AF1267
Serpin C1/Antithrombin-III Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: IP, Neut, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(66 Publications)
Species: Hu
Applications: ELISA
Complement C3
Antibody (11H9) - BSA ...
NB200-540
Flow Cytometry Complement C3 Antibody (11H9) - BSA Free
Immunocytochemistry/ Immunofluorescence Complement C3 Antibody (11H9) - BSA Free
Immunohistochemistry-Paraffin Complement C3 Antibody (11H9) - BSA Free
(2 Reviews)
(30 Publications)
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Haptoglobin [HRP]
DHAPG0
N/A Haptoglobin [HRP]
N/A Haptoglobin [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Serpin A3/alpha
1-Antichymotrypsin An ...
NBP2-52559
Western Blot Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) - BSA Free
ELISA Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) - BSA Free
Flow Cytometry Serpin A3/alpha 1-Antichymotrypsin Antibody (5G3C11) - BSA Free
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
LRP-1 Antibody
(A2Mr alpha-2) - BSA ...
NB100-64808
Immunohistochemistry LRP-1 Antibody (A2Mr alpha-2) - BSA Free
Immunohistochemistry LRP-1 Antibody (A2Mr alpha-2) - BSA Free
Immunohistochemistry LRP-1 Antibody (A2Mr alpha-2) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(63 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(52 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Presenilin-1
Antibody (APS 18)
NB100-74510
Western Blot Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
Immunocytochemistry/ Immunofluorescence Presenilin-1 Antibody (APS 18)
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Coagulation Factor
II/Thrombin Antibody
NBP1-58268
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Immunohistochemistry-Paraffin Coagulation Factor II/Thrombin Antibody
Western Blot Coagulation Factor II/Thrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Neutrophil
Elastase/ELA2 [Biotin
DY4517-05
N/A Neutrophil Elastase/ELA2 [Biotin]
(14 Publications)
Species: Mu
Applications: ELISA
alpha
2-Macroglobulin Recom ...
NBP1-85491PEP
alpha 2-Macroglobulin Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP) (0)

There are no publications for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP) (0)

There are no reviews for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha 2-Macroglobulin Products

Research Areas for alpha 2-Macroglobulin Recombinant Protein Antigen (NBP1-85491PEP)

Find related products by research area.

Blogs on alpha 2-Macroglobulin

There are no specific blogs for alpha 2-Macroglobulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
beta Amyloid Antibody (MOAB-2) - BSA Free
NBP2-13075
Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alpha 2-Macroglobulin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol A2M