![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human liver shows low positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0011.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human liver shows low positivity in hepatocytes as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADO |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADO |
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human testis shows cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0004.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human testis shows cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human cerebral cortex shows strong positivity in neurons.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0005.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human cerebral cortex shows strong positivity in neurons.")
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human smooth muscle shows moderate positivity.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0006.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human smooth muscle shows moderate positivity.")
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0007.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Analysis in human testis and liver tissues. Corresponding RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0008.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Analysis in human testis and liver tissues. Corresponding RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0009.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Analysis in human testis and liver tissues. Corresponding ADO RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ADO-Antibody-Immunohistochemistry-Paraffin-NBP1-88530-img0010.jpg "Immunohistochemistry-Paraffin: ADO Antibody [NBP1-88530] - Analysis in human testis and liver tissues. Corresponding ADO RNA-seq data are presented for the same tissues.")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")