Home » Adenosylhomocysteinase/AHCY » Adenosylhomocysteinase/AHCY Proteins » Adenosylhomocysteinase/AHCY Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Adenosylhomocysteinase/AHCY Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Adenosylhomocysteinase/AHCY Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Adenosylhomocysteinase/AHCY.

Source: E. coli

Amino Acid Sequence: MEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AHCY
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48731.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen

  • Adenosylhomocysteinase
  • AdoHcyase
  • AHCY
  • EC 3.3.1.1
  • S-adenosylhomocysteine hydrolase
  • S-adenosyl-L-homocysteine hydrolase
  • SAHH
  • SAHHadoHcyase

Background

S-adenosylhomocysteine hydrolase catalyzes the reversible hydrolysis of S-adenosylhomocysteine (AdoHcy) to adenosine (Ado) and L-homocysteine (Hcy). Thus, it regulates the intracellular S-adenosylhomocysteine (SAH) concentration thought to be important for transmethylation reactions. Deficiency in this protein is one of the different causes of hypermethioninemia. S-adenosylhomocysteine hydrolase belongs to the adenosylhomocysteinase family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
ACSM3 Antibody
H00006296-D01P
Western Blot ACSM3 Antibody
Western Blot ACSM3 Antibody
Species: Hu, Mu
Applications: WB
ADK Antibody
NBP2-15291
Immunohistochemistry-Paraffin ADK Antibody
Western Blot ADK Antibody
Western Blot ADK Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ADO Antibody
NBP1-88530
Immunohistochemistry-Paraffin ADO Antibody
Immunohistochemistry-Paraffin ADO Antibody
Immunohistochemistry-Paraffin ADO Antibody
Species: Hu
Applications: IHC, IHC-P
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CBS Antibody
NBP1-33518
Western Blot CBS Antibody
Immunoprecipitation CBS Antibody
Western Blot CBS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
Glycine
N-Methyltransferase/G ...
NBP1-89512
Immunocytochemistry/ Immunofluorescence Glycine N-Methyltransferase/GNMT Antibody
Immunohistochemistry-Paraffin Glycine N-Methyltransferase/GNMT Antibody
Immunohistochemistry-Paraffin Glycine N-Methyltransferase/GNMT Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Purine Nucleoside
Phosphorylase/PNP Ant ...
NBP1-82541
Western Blot Purine Nucleoside Phosphorylase/PNP Antibody
Immunohistochemistry-Paraffin Purine Nucleoside Phosphorylase/PNP Antibody
Immunohistochemistry-Paraffin Purine Nucleoside Phosphorylase/PNP Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AHCYL1 Antibody
NBP1-83093
Immunocytochemistry/ Immunofluorescence AHCYL1 Antibody
Western Blot AHCYL1 Antibody
Western Blot AHCYL1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MTR Antibody
NB100-791
Western Blot MTR Antibody
Immunohistochemistry-Paraffin MTR Antibody
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
MTHFR Antibody
(5D3) - BSA Free
NBP2-37607
Immunohistochemistry-Paraffin MTHFR Antibody (5D3) - BSA Free
ELISA MTHFR Antibody (5D3) - BSA Free
Western Blot MTHFR Antibody (5D3) - BSA Free
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(374 Publications)
Species: Hu
Applications: BA
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
IP3R1 Antibody
NBP1-21398
Immunohistochemistry-Paraffin IP3R1 Antibody
Western Blot IP3R1 Antibody
Immunohistochemistry-Paraffin IP3R1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
EZH2/KMT6 Antibody
[Unconjugated]
AF4767
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
Western Blot EZH2/KMT6 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: ICC, WB

Adenosylhomocysteinase ...
NBP2-48731PEP
Adenosylhomocysteinase/AHCY Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP) (0)

There are no publications for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP) (0)

There are no reviews for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adenosylhomocysteinase/AHCY Products

Research Areas for Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48731PEP)

Find related products by research area.

Blogs on Adenosylhomocysteinase/AHCY

There are no specific blogs for Adenosylhomocysteinase/AHCY, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Adenosylhomocysteinase/AHCY Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol AHCY