![Western Blot: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Analysis in human cell line MOLT-4.](http://images.novusbio.com/fullsize/Adenosine-Deaminase-2-CECR1-Antibody-Western-Blot-NBP1-89238-img0010.jpg "Western Blot: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Analysis in human cell line MOLT-4.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAVRTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CECR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89238 | Applications | Species |
|---|---|---|
| Tiwari-Heckler S, Yee EU, Yalcin Y Et al. Adenosine deaminase 2 produced by infiltrative monocytes promotes liver fibrosis in nonalcoholic fatty liver disease Cell reports 2021-10-26 [PMID: 34706243] (FLOW, Human) | FLOW | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Adenosine Deaminase 2/CECR1 Antibody (NBP1-89238)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CECR1 |
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0015.jpg "Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.](http://images.novusbio.com/fullsize/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0012.jpg "Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.")
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0013.jpg "Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Adenosine-Deaminase-2-CECR1-Antibody-Immunohistochemistry-Paraffin-NBP1-89238-img0014.jpg "Immunohistochemistry-Paraffin: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Simple Western: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Simple Western lane view shows a specific band for CECR1 in 0.2 mg/ml of h. Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/Adenosine-Deaminase-2-CECR1-Antibody-Simple-Western-NBP1-89238-img0006.jpg "Simple Western: Adenosine Deaminase 2/CECR1 Antibody [NBP1-89238] - Simple Western lane view shows a specific band for CECR1 in 0.2 mg/ml of h. Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")