Adenine Nucleotide Translocator 2 Antibody Summary
Immunogen |
Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2. Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
SLC25A5 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA 1:10000
- Immunocytochemistry/ Immunofluorescence 1:100
- Immunohistochemistry 1:100
- Immunohistochemistry-Paraffin
- Immunoprecipitation 1:200
- Western Blot 1:500
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
Contains Tris, HCl/glycine buffer (pH 7.4-7.8), 30% glycerol, 0.5% BSA, along with cryo-protective agents, and HEPES (exact storage and stabilization buffer information is proprietary). |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Adenine Nucleotide Translocator 2 Antibody
Background
ADP/ATP translocase, the most abundant mitochondrial protein, is an integral component of the inner mitochondrial membrane. It facilitates exchange of ADP and ATP between the cytosol and the mitochondria, thereby linking the subcellular compartment of ATP production to those of ATP utilization. SLC25A5 is 1 of at least 3 transcriptionally active ADP/ATP translocase genes in humans (Chen et al., 1990 [PubMed 2157297]). Battini et al. (1987) [PubMed 3031073] cloned an ADP/ATP translocase gene from an Okayama-Berg library derived from SV40-transformed human fibroblasts. Ku et al. (1990) [PubMed 2168878] cloned and sequenced the ANT2 gene. Chen et al. (1990) [PubMed 2157297] isolated 7 ADP/ATP translocase pseudogenes from recombinant human genomic libraries. Each pseudogene sequence had more than 85% identity with the sequence of the translocase cDNA derived from fibroblast mRNA, but each had mutations that precluded synthesis of a functional protein.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IP
Publications for Adenine Nucleotide Translocator 2 Antibody (NBP3-12220) (0)
There are no publications for Adenine Nucleotide Translocator 2 Antibody (NBP3-12220).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Adenine Nucleotide Translocator 2 Antibody (NBP3-12220) (0)
There are no reviews for Adenine Nucleotide Translocator 2 Antibody (NBP3-12220).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Adenine Nucleotide Translocator 2 Antibody (NBP3-12220) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Adenine Nucleotide Translocator 2 Products
Research Areas for Adenine Nucleotide Translocator 2 Antibody (NBP3-12220)
Find related products by research area.
|
Blogs on Adenine Nucleotide Translocator 2