![Immunocytochemistry/Immunofluorescence: ABCB11 Antibody [NBP2-92689] - Immunofluorescence analysis of HeLa cells using ABCB11 antibody (NBP2-92689) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ABCB11-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92689-img0002.jpg "Immunocytochemistry/Immunofluorescence: ABCB11 Antibody [NBP2-92689] - Immunofluorescence analysis of HeLa cells using ABCB11 antibody (NBP2-92689) at dilution of 1:100. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1050-1150 of human ABCB11 (NP_003733.2). RFFQLLDRQPPISVYNTAGEKWDNFQGKIDFVDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMIDGHDSKKVNVQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ABCB11 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 146 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ABCB11 Antibody (NBP2-92689)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ABCB11 |
![Immunocytochemistry/Immunofluorescence: ABCB11 Antibody [NBP2-92689] - Analysis of NIH-3T3 cells using ABCB11 . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/ABCB11-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92689-img0001.jpg "Immunocytochemistry/Immunofluorescence: ABCB11 Antibody [NBP2-92689] - Analysis of NIH-3T3 cells using ABCB11 . Blue: DAPI for nuclear staining.")
![Western Blot: ABCB11 Antibody - Azide and BSA Free [NBP2-92689] - Western blot analysis of lysates from Mouse liver, using ABCB11 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.](http://images.novusbio.com/fullsize/nbp2-92689_rabbit-polyclonal-abcb11-antibody-4220251430479.jpg "Western Blot: ABCB11 Antibody - Azide and BSA Free [NBP2-92689] - Western blot analysis of lysates from Mouse liver, using ABCB11 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.")
![Immunocytochemistry CYP7A1 Antibody (946902) [Unconjugated]](https://images.novusbio.com/images2/CYP7A1_MAB9120_Immunocytochemistry__Immunofluorescence_19938.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")