![Western Blot: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of extracts of various cell lines, using ALOX15B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 2s.](http://images.novusbio.com/fullsize/15-Lipoxygenase-2-Antibody-Western-Blot-NBP2-92668-img0002.jpg "Western Blot: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of extracts of various cell lines, using ALOX15B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 2s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human 15-Lipoxygenase 2 (NP_001132.2). MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALOX15B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
| Publication using NBP2-92668 | Applications | Species |
|---|---|---|
| Li C, Sun G, Chen B Et al. Nuclear receptor coactivator 4-mediated ferritinophagy contributes to cerebral ischemia-induced ferroptosis in ischemic stroke Pharmacological research Oct 8 2021 [PMID: 34634471] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for 15-Lipoxygenase 2 Antibody (NBP2-92668)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALOX15B |
![Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of U2OS cells using ALOX15B Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/15-Lipoxygenase-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92668-img0005.jpg "Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of U2OS cells using ALOX15B Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of NIH/3T3 cells using ALOX15B Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/15-Lipoxygenase-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92668-img0003.jpg "Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of NIH/3T3 cells using ALOX15B Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of PC-12 cells using ALOX15B Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/15-Lipoxygenase-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92668-img0004.jpg "Immunocytochemistry/Immunofluorescence: 15-Lipoxygenase 2 Antibody [NBP2-92668] - Analysis of PC-12 cells using ALOX15B Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")