ZNF384 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human ZNF384 (NP_001129206.1). MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKSDQLTPHS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ZNF384 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for ZNF384 Antibody - Azide and BSA Free
Background
The ZNF384 gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functionsas a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The proteinappears to bind an
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for ZNF384 Antibody (NBP2-94454) (0)
There are no publications for ZNF384 Antibody (NBP2-94454).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF384 Antibody (NBP2-94454) (0)
There are no reviews for ZNF384 Antibody (NBP2-94454).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF384 Antibody (NBP2-94454) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF384 Products
Blogs on ZNF384