Novus Biologicals products are now on bio-techne.com

ZMPSTE24 Recombinant Protein Antigen

Images

 
There are currently no images for ZMPSTE24 Protein (NBP1-84755PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ZMPSTE24 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZMPSTE24.

Source: E. coli

Amino Acid Sequence: KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ZMPSTE24
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84755.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ZMPSTE24 Recombinant Protein Antigen

  • zona pellucida binding protein 2
  • zona pellucida-binding protein 2
  • ZPBP-like protein
  • ZPBPLMGC41930

Background

ZMPSTE24, also known as FACE1, is a zinc metalloprotease involved in the post-translational processing of Lamin A/C precursors. Specifically, ZMPSTE-24 proteolytically removes the C-terminal three residues of the farnesylated Lamin proteins.

FACE-1 is widely expressed, with the highest levels found in the kidney, prostate, testis and ovary.

Mutations in ZMPSTE24 have been associated with human diseases such as mandibuloacral dysplasia with type B lipodystrophy (MADB) and lethal tight skin contracture syndrome (LTSCS), often due to the accumulation of LMNA precursors. It is theorized that ZMPSTE24 may play an important role in human ageing, based on its association with LMNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25151
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
NBP3-35836
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-83368
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-68766
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-57578
Species: Hu
Applications: WB
NBP1-87349
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP3-12316
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-24509
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
H00008815-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF7385
Species: Hu
Applications: ICC, WB
NBP2-85249
Species: Hu, Mu
Applications: WB
NBP2-62573
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-84755PEP
Species: Hu
Applications: AC

Publications for ZMPSTE24 Protein (NBP1-84755PEP) (0)

There are no publications for ZMPSTE24 Protein (NBP1-84755PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZMPSTE24 Protein (NBP1-84755PEP) (0)

There are no reviews for ZMPSTE24 Protein (NBP1-84755PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ZMPSTE24 Protein (NBP1-84755PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZMPSTE24 Products

Research Areas for ZMPSTE24 Protein (NBP1-84755PEP)

Find related products by research area.

Blogs on ZMPSTE24.

ZMPSTE24 Mutations, Lamin A Processing & Laminopathies
ZMPSTE24 (FACE-1, CAAX prenyl protease 1 homolog) is a membrane associated zinc metalloprotease of the peptidase M48A family. It's catalytic activity can be defined as the peptide bond hydrolyzed in the sequence -C-|-A-A-X in which C is an S-isoprenyl...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ZMPSTE24 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ZMPSTE24