Home » ZHX2 » ZHX2 Antibodies » ZHX2 Antibody (8N7O2)
Novus Biologicals products are now on bio-techne.com

ZHX2 Antibody (8N7O2)

 Submit a Review

Images

 
There are currently no images for ZHX2 Antibody (NBP3-33214).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
8N7O2
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ZHX2 Antibody (8N7O2) Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 260-500 of human ZHX2 (Q9Y6X8).

Sequence:
VPLNTTKYNSALDTNATMINSFNKFPYPTQAELSWLTAASKHPEEHIRIWFATQRLKHGISWSPEEVEEARKKMFNGTIQSVPPTITVLPAQLAPTKVTQPILQTALPCQILGQTSLVLTQVTSGSTTVSCSPITLAVAGVTNHGQKRPLVTPQAAPEPKRPHIAQVPEPPPKVANPPLTPASDRKKTKEQIAHLKASFLQSQFPDDAEVYRLIEVTGLARSEIKKWFSDHRYRCQRGIVH
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
ZHX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
Theoretical MW
92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZHX2 Antibody (8N7O2)

  • zona pellucida glycoprotein 2 (sperm receptor)
  • Zona pellucida glycoprotein 2
  • zona pellucida glycoprotein ZP2
  • Zona pellucida protein A
  • zona pellucida sperm-binding protein 2
  • Zp-2
  • ZPA

Background

The members of the zinc fingers and homeoboxes gene family are nuclear homodimeric transcriptional repressors that interact with the A subunit of nuclear factor-Y (NF-YA) and contain two C2H2-type zinc fingers and five homeobox DNA-binding domains. This gene encodes member 2 of this gene family. In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
MEK1 Antibody
(OTI1F5)
NBP1-47833
Western Blot MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
Immunohistochemistry-Paraffin MEK1 Antibody (OTI1F5)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(828 Publications)
Species: Hu
Applications: BA
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
HRAS Antibody
NBP2-42864
Western Blot HRAS Antibody
Western Blot HRAS Antibody
Western Blot HRAS Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
SNRPE Antibody
NBP2-43792
Western Blot SNRPE Antibody
Immunohistochemistry-Paraffin SNRPE Antibody
Immunohistochemistry-Paraffin SNRPE Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
B-Raf Antibody
(OTI5A9)
NBP1-47668
Immunohistochemistry B-Raf Antibody (OTI5A9)
Western Blot B-Raf Antibody (OTI5A9)
Flow Cytometry B-Raf Antibody (OTI5A9)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
ZHX2 Antibody
(8N7O2)
NBP3-33214
ZHX2 Antibody (8N7O2)
Species: Hu, Mu
Applications: WB, ELISA

Publications for ZHX2 Antibody (NBP3-33214) (0)

There are no publications for ZHX2 Antibody (NBP3-33214).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZHX2 Antibody (NBP3-33214) (0)

There are no reviews for ZHX2 Antibody (NBP3-33214). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZHX2 Antibody (NBP3-33214) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZHX2 Products

Research Areas for ZHX2 Antibody (NBP3-33214)

Find related products by research area.

Blogs on ZHX2

There are no specific blogs for ZHX2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZHX2 Antibody (8N7O2) and receive a gift card or discount.


Bioinformatics

Gene Symbol ZHX2