![Western Blot: ZBTB38 Antibody [NBP2-88606] - Host: Rabbit. Target Name: ZBTB38. Sample Tissue: Human Hela. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/ZBTB38-Antibody-Western-Blot-NBP2-88606-img0002.jpg "Western Blot: ZBTB38 Antibody [NBP2-88606] - Host: Rabbit. Target Name: ZBTB38. Sample Tissue: Human Hela. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human ZBTB38. Peptide sequence: MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZBTB38 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZBTB38 |
![Immunohistochemistry: ZBTB38 Antibody [NBP2-88606] - Human kidney](http://images.novusbio.com/fullsize/ZBTB38-Antibody-Immunohistochemistry-NBP2-88606-img0001.jpg "Immunohistochemistry: ZBTB38 Antibody [NBP2-88606] - Human kidney")
![Western Blot: ZBTB38 Antibody [NBP2-88606] - Host: Rabbit. Target: ZBTB38. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): 293T Cell Lysate (2T). Antibody concentration: 3ug/ml](http://images.novusbio.com/fullsize/ZBTB38-Antibody-Western-Blot-NBP2-88606-img0003.jpg "Western Blot: ZBTB38 Antibody [NBP2-88606] - Host: Rabbit. Target: ZBTB38. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): 293T Cell Lysate (2T). Antibody concentration: 3ug/ml")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![N/A MMP-7 [HRP]](https://images.novusbio.com/images2/MMP7_DMP700_ELISA_498.jpg)
![N/A MMP-7 [HRP]](https://images.novusbio.com/images2/DATA_MMP7_DMP700_ELISA_768.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunohistochemistry Reelin Antibody [Unconjugated]](https://images.novusbio.com/images2/Reelin_AF3820_Immunohistochemistry_18505.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
