![Western Blot: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of extracts of various cell lines, using YB1 Rabbit mAb (NBP3-16213) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Western-Blot-NBP3-16213-img0008.jpg "Western Blot: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of extracts of various cell lines, using YB1 Rabbit mAb (NBP3-16213) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, ChIP |
| Clone | 9J7M4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB1 (P67809). GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | YBX1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for YB1 Antibody (NBP3-16213)Find related products by research area.
|
|
Understanding ‘Y’ in Breast Cancer: Crucial Role of DNA/RNA-binding Protein YB-1 in the Development, Pre-Invasive, and Metastatic Phases Jamshed Arslan, Pharm D, PhD In the United States, 1 in 8 women will be diagnosed with breast cancer in her lifetime.1 Despite the prevalence, cancer genesis is a mystery. The heterogeneity of cancers makes it diff... Read full blog post. |
|
New Techniques Using Phosphoserine Antibodies Phosphoserine, the phosphorylated modification of the amino acid serine, is a central post-translational modification within a cell for many biological and biomedical processes. The phosphorylation of specifically four residue types - histidine, serin... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | YBX1 |
![Immunocytochemistry/Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Immunofluorescence analysis of U-2 OS cells using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunocytochemistry-Immunofluorescence-NBP3-16213-img0006.jpg "Immunocytochemistry/Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Immunofluorescence analysis of U-2 OS cells using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: YB1 Antibody (9J7M4) [NBP3-16213] - Mouse brain using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunohistochemistry-Paraffin-NBP3-16213-img0003.jpg "Immunohistochemistry-Paraffin: YB1 Antibody (9J7M4) [NBP3-16213] - Mouse brain using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Chromatin Immunoprecipitation: YB1 Antibody (9J7M4) [NBP3-16213] - Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using YB1 antibody (NBP3-16213) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Chromatin-Immunoprecipitation-NBP3-16213-img0010.jpg "Chromatin Immunoprecipitation: YB1 Antibody (9J7M4) [NBP3-16213] - Chromatin immunoprecipitation analysis of extracts of MCF7 cells, using YB1 antibody (NBP3-16213) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![Western Blot: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of extracts of HeLa cells, using YB1 Rabbit mAb (NBP3-16213) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Western-Blot-NBP3-16213-img0007.jpg "Western Blot: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of extracts of HeLa cells, using YB1 Rabbit mAb (NBP3-16213) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Immunocytochemistry/Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Immunofluorescence analysis of C6 cells using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunocytochemistry-Immunofluorescence-NBP3-16213-img0004.jpg "Immunocytochemistry/Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Immunofluorescence analysis of C6 cells using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Immunofluorescence analysis of NIH-3T3 cells using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunocytochemistry-Immunofluorescence-NBP3-16213-img0005.jpg "Immunocytochemistry/Immunofluorescence: YB1 Antibody (9J7M4) [NBP3-16213] - Immunofluorescence analysis of NIH-3T3 cells using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: YB1 Antibody (9J7M4) [NBP3-16213] - Rat brain using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunohistochemistry-Paraffin-NBP3-16213-img0001.jpg "Immunohistochemistry-Paraffin: YB1 Antibody (9J7M4) [NBP3-16213] - Rat brain using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: YB1 Antibody (9J7M4) [NBP3-16213] - Human oophoroma using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunohistochemistry-Paraffin-NBP3-16213-img0002.jpg "Immunohistochemistry-Paraffin: YB1 Antibody (9J7M4) [NBP3-16213] - Human oophoroma using YB1 Rabbit mAb (NBP3-16213) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of 300ug extracts of HeLa cells using 3ug YB1 antibody (NBP3-16213). Western blot was performed from the immunoprecipitate using YB1 (NBP3-16213) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/YB1-Antibody-9J7M4-Immunoprecipitation-NBP3-16213-img0009.jpg "Immunoprecipitation: YB1 Antibody (9J7M4) [NBP3-16213] - Analysis of 300ug extracts of HeLa cells using 3ug YB1 antibody (NBP3-16213). Western blot was performed from the immunoprecipitate using YB1 (NBP3-16213) at a dilition of 1:1000.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")