| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1322-1432 of Human WRN Source: Wheat Germ (in vitro) Amino Acid Sequence: NPPVNSDMSKISLIRMLAPENIDTYLIHMAIEILKHGPDSGLQPSCDVNKRRCFPGSEEICSSSKRSKEEVGINTETSSAERKRRLPVWFAKGSDTSKKLMDKTKRGGLFS |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | WRN |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 37.95 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00007486-Q01 | Applications | Species |
|---|---|---|
| Sadahira Y, Sugihara T, Fujiwara H et al. WRN protein as a novel erythroblast immunohistochemical marker with applications for the diagnosis of Werner syndrome. Virchows Arch 2015-03-01 [PMID: 25503078] |
Research Areas for WRN Partial Recombinant Protein (H00007486-Q01)Find related products by research area.
|
|
Not as Pluripotent as You Used to Be: Embryonic Stem Cell Markers and the Aging Process We at Novus Biologicals recently extended our antibody catalog to include several embryonic stem cells (ESC) antibodies validated for use in FACS (fluorescent activated cell sorting) assays. Among them was Oct4, which recently became the focus of an i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | WRN |
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Immunoprecipitation: WRN Antibody [NB100-471] - Detection of human WRN by western blot and immunoprecipitation. Samples: Whole cell lysate (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-WRN antibody NB100-471 used for WB at 0.2 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate. WRN was also immunoprecipitated by rabbit anti-WRN antibody NB100-472, which recognizes a downstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 seconds (B).](https://images.novusbio.com/images/WRN-Antibody-Immunoprecipitation-NB100-471-img0008.jpg "Immunoprecipitation: WRN Antibody [NB100-471] - Detection of human WRN by western blot and immunoprecipitation. Samples: Whole cell lysate (5, 15 and 50 ug for WB; 1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-WRN antibody NB100-471 used for WB at 0.2 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate. WRN was also immunoprecipitated by rabbit anti-WRN antibody NB100-472, which recognizes a downstream epitope. Detection: Chemiluminescence with exposure times of 30 seconds (A) and 3 seconds (B).")