Novus Biologicals products are now on bio-techne.com

WIRE Recombinant Protein Antigen

Name: WIRE Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-86858PEP
Price: 279 USD

Images

There are currently no images for WIRE Protein (NBP1-86858PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

WIRE Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WIPF2. Source: E. coli Amino Acid Sequence: PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	WIPF2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86858. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WIRE Recombinant Protein Antigen

PP10631
WAS/WASL interacting protein family, member 2
WIP-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GPSM2 Antibody

NBP1-53125

Immunocytochemistry/ Immunofluorescence GPSM2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Serpin A5/Protein
C Inhibitor Antibody ...

MAB1266

(2 Publications)

Species: Hu

Applications: CyTOF-ready, IP, ICFlow, WB

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

SI
Sucrase-Isomaltase An

NBP1-87581

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

GRIP1 Antibody -
BSA Free

NBP2-41211

Immunohistochemistry GRIP1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence GRIP1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

hnRNP C1 + C2
Antibody (CL2593)

NBP2-36776

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

LIGHT/TNFSF14
[Unconjugated]

664-LI

Bioactivity LIGHT/TNFSF14 [Unconjugated]

(21 Publications)

Species: Hu

Applications: BA

CRAT Antibody

NBP1-86616

Immunohistochemistry-Paraffin CRAT Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

GLYAT Antibody

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Complement
Component C2 Antibody ...

AF1936

(1 Publication)

Species: Hu

Applications: IP, WB

POMC Antibody

NB100-1533

(10 Publications)

Species: Hu, Mu, Po, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

SS18L1 Antibody

NBP2-20486

Immunohistochemistry-Paraffin SS18L1 Antibody

Immunocytochemistry/ Immunofluorescence SS18L1 Antibody

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

Endothelin-1 [HRP]

QET00B

(47 Publications)

Species: Hu

Applications: ELISA

ARC/NOL3 Antibody

NBP2-19561

Immunohistochemistry-Frozen ARC/NOL3 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

ARC/ARG3.1 Antibody

NBP1-56929

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

eNOS Antibody -
BSA Free

NB300-500

Immunohistochemistry-Paraffin eNOS Antibody - BSA Free

(3 Reviews)

(28 Publications)

Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh

Applications: IHC, IHC-Fr, IHC-P, WB

Nucleostemin
Antibody [Unconjugate

AF1638

Simple Western Nucleostemin Antibody [Unconjugated]

Western Blot Nucleostemin Antibody [Unconjugated]

(9 Publications)

Species: Hu, Mu, Rt

Applications: ICC, Simple Western, WB

KRAS Antibody
(3B10-2F2)

H00003845-M01

(1 Review)

(17 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IP, WB

Fucosyltransferase
3/FUT3 Antibody (2-25 ...

NB500-526

(3 Publications)

Species: Hu

Applications: ELISA, IHC, IHC-P, WB

Publications for WIRE Protein (NBP1-86858PEP) (0)

There are no publications for WIRE Protein (NBP1-86858PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WIRE Protein (NBP1-86858PEP) (0)

There are no reviews for WIRE Protein (NBP1-86858PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WIRE Protein (NBP1-86858PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WIRE Products

Blogs on WIRE

There are no specific blogs for WIRE, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

$Western Blot: eNOS Antibody - BSA Free [NB300-500] - Fractionated, compared to single exposure, radiation more profoundly suppressed TM and eNOS. Representative Western blot analysis and quantification of KLF2 (n = 5) and KLF4 (n = 3) levels in whole-cell lysates from nonirradiated (sham) and irradiated HUVECs 4 h and 24 h after exposure to either five fractions of 2 Gy (5 x 2 Gy) or single exposure to 10 Gy. Fractions delivered at 24-h intervals. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32382091/) licensed under a CC-BY license.$

eNOS Antibody - BSA Free
NB300-500

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our WIRE Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

WIPF2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

WIRE Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

WIRE Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for WIRE Recombinant Protein Antigen

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for WIRE Protein (NBP1-86858PEP) (0)

Reviews for WIRE Protein (NBP1-86858PEP) (0)

FAQs for WIRE Protein (NBP1-86858PEP) (0)

Additional WIRE Products

Blogs on WIRE

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics