![Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human cerebral cortex, colon, kidney and testis using Anti-WDR61 antibody NBP1-80844 (A) shows similar protein distribution across tissues to independent antibody NBP1-80845 (B).](http://images.novusbio.com/fullsize/WDR61-Antibody-Immunohistochemistry-Paraffin-NBP1-80844-img0012.jpg "Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human cerebral cortex, colon, kidney and testis using Anti-WDR61 antibody NBP1-80844 (A) shows similar protein distribution across tissues to independent antibody NBP1-80845 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DISHTLPIAASSSLDAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SKIC8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-80844 | Applications | Species |
|---|---|---|
| Zwida KH, Kutzler MA. Canine splenic hemangiosarcoma cells express and activate luteinizing hormone receptors in vitro Am J Vet Res 2022-11-03 [PMID: 36327166] (ICC/IF, Canine) Details: Citation using the FITC version of this antibody. |
ICC/IF | Canine |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: WDR61 Antibody [NBP1-80844] - Analysis using Anti-WDR61 antibody NBP1-80844 (A) shows similar pattern to independent antibody NBP1-80845 (B).](http://images.novusbio.com/fullsize/WDR61-Antibody-Western-Blot-NBP1-80844-img0013.jpg "Western Blot: WDR61 Antibody [NBP1-80844] - Analysis using Anti-WDR61 antibody NBP1-80844 (A) shows similar pattern to independent antibody NBP1-80845 (B).")
![Immunocytochemistry/Immunofluorescence: WDR61 Antibody [NBP1-80844] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.](http://images.novusbio.com/fullsize/WDR61-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80844-img0011.jpg "Immunocytochemistry/Immunofluorescence: WDR61 Antibody [NBP1-80844] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.")
![Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/WDR61-Antibody-Immunohistochemistry-Paraffin-NBP1-80844-img0016.jpg "Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.")
![Western Blot: WDR61 Antibody [NBP1-80844] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/WDR61-Antibody-Western-Blot-NBP1-80844-img0010.jpg "Western Blot: WDR61 Antibody [NBP1-80844] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human testis shows strong nuclear and cytoplasmic positivity in subsets of cells in seminiferus ducts.](http://images.novusbio.com/fullsize/WDR61-Antibody-Immunohistochemistry-Paraffin-NBP1-80844-img0009.jpg "Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human testis shows strong nuclear and cytoplasmic positivity in subsets of cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human rectum shows moderate cytoplasmic positivyt in glandular cells.](http://images.novusbio.com/fullsize/WDR61-Antibody-Immunohistochemistry-Paraffin-NBP1-80844-img0014.jpg "Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human rectum shows moderate cytoplasmic positivyt in glandular cells.")
![Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/WDR61-Antibody-Immunohistochemistry-Paraffin-NBP1-80844-img0015.jpg "Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80844] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")