Home » VPS54 » VPS54 Proteins » VPS54 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

VPS54 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for VPS54 Recombinant Protein Antigen (NBP2-57640PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

VPS54 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS54.

Source: E. coli

Amino Acid Sequence: EKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VPS54
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57640.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VPS54 Recombinant Protein Antigen

  • HCC8SLP-8p
  • Hepatocellular carcinoma protein 8
  • hVps54L
  • Tumor antigen HOM-HCC-8
  • Tumor antigen SLP-8p
  • vacuolar protein sorting 54 (yeast)
  • vacuolar protein sorting 54 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 54
  • VPS54L

Background

VPS54 encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Lipoprotein
Lipase/LPL Antibody [ ...
AF7197
Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]
Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
PAMR1 Antibody
AF6517
Western Blot PAMR1 Antibody
Species: Hu
Applications: WB
CDT2 Antibody
NB100-40840
Immunoprecipitation CDT2 Antibody
Western Blot CDT2 Antibody
Immunohistochemistry-Paraffin CDT2 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
ZNF198 Antibody
NBP1-84685
Immunohistochemistry-Paraffin ZNF198 Antibody
Immunohistochemistry-Paraffin ZNF198 Antibody
Immunohistochemistry-Paraffin ZNF198 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Recombinant Human
VPS52 GST (N-Term) Pr ...
H00006293-P01
Other Recombinant Human VPS52 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Integrin alpha
2/CD49b Antibody (HAS ...
MAB1233
Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Complement Factor
H Antibody [Unconjuga ...
AF4779
Immunohistochemistry Complement Factor H Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
TMEM37 Antibody
NBP2-47602
Immunocytochemistry/ Immunofluorescence TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Immunohistochemistry-Paraffin TMEM37 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Complement C4
Antibody
NBP3-12295
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Immunohistochemistry-Paraffin Complement C4 Antibody
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
(2 Reviews)
(11 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Nucleostemin
Antibody [Unconjugate
AF1638
Immunocytochemistry Nucleostemin Antibody [Unconjugated]
Simple Western Nucleostemin Antibody [Unconjugated]
Western Blot Nucleostemin Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB

Publications for VPS54 Recombinant Protein Antigen (NBP2-57640PEP) (0)

There are no publications for VPS54 Recombinant Protein Antigen (NBP2-57640PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS54 Recombinant Protein Antigen (NBP2-57640PEP) (0)

There are no reviews for VPS54 Recombinant Protein Antigen (NBP2-57640PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VPS54 Recombinant Protein Antigen (NBP2-57640PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS54 Products

Array NBP2-57640PEP

Blogs on VPS54

There are no specific blogs for VPS54, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VPS54 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol VPS54