Home » VDAC1 » VDAC1 Proteins » VDAC1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

VDAC1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for VDAC1 Protein (NBP2-38163PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

VDAC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VDAC1.

Source: E. coli

Amino Acid Sequence: KWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VDAC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38163.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for VDAC1 Recombinant Protein Antigen

  • hVDAC1
  • MGC111064
  • Outer mitochondrial membrane protein porin 1
  • Plasmalemmal porin
  • Porin 31HL
  • Porin 31HM
  • PORIN
  • PORIN-31-HL
  • VDAC
  • VDAC1
  • VDAC-1
  • voltage-dependent anion channel 1
  • voltage-dependent anion-selective channel protein 1

Background

VDAC1 is an outer membrane mitochondrial protein. The VDAC proteins are thought to form aqueous channels, or pores, through which adenine nucleotides cross the outer mitochondrial membrane. VDACs have been implicated in the formation of the mitochondrial permeability transition pore complex in apoptotic cells. This complex, formed by VDAC, adenine nucleotide translocator (ANT), and cyclophilin D (CypD), is thought to allow the mitochondria to undergo metabolic uncoupling and irreversible morphologic changes that ultimately destroy the mitochondria during apoptosis. VDACs are highly expressed in heart, liver and skeletal muscle, where concentrations of mitochondria are at their highest.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VDAC2 Antibody
NBP2-20849
Immunohistochemistry-Paraffin VDAC2 Antibody
Immunohistochemistry-Paraffin VDAC2 Antibody
Immunoprecipitation VDAC2 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
VDAC3 Antibody
NBP1-80070
Western Blot VDAC3 Antibody
Western Blot VDAC3 Antibody
Immunohistochemistry VDAC3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Olfactory Marker
Protein Antibody - Az ...
NB110-74751
Olfactory Marker Protein Antibody - Azide and BSA Free
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(28 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Adenine Nucleotide
Translocase 1 Antibod ...
NBP3-35061
Western Blot Adenine Nucleotide Translocase 1 Antibody (3C1Q3)
Immunoprecipitation Adenine Nucleotide Translocase 1 Antibody (3C1Q3)
Western Blot Adenine Nucleotide Translocase 1 Antibody (3C1Q3)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
PBR Antibody
NB100-41398
Flow Cytometry PBR Antibody
Immunocytochemistry/ Immunofluorescence PBR Antibody
Immunocytochemistry/ Immunofluorescence PBR Antibody
(13 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
B3GALNT1 Antibody
- BSA Free
NBP2-92677
Western Blot B3GALNT1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: WB
NUCKS1 Antibody
NB100-74635
Immunohistochemistry-Paraffin NUCKS1 Antibody
Immunoprecipitation NUCKS1 Antibody
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Protamine 1
Antibody
NBP2-30949
Immunohistochemistry-Paraffin Protamine 1 Antibody
Immunohistochemistry-Paraffin Protamine 1 Antibody
Immunohistochemistry-Paraffin Protamine 1 Antibody
Species: Hu
Applications: IHC, IHC-P
Perforin Antibody
(CB5.4) - BSA Free
NBP1-97512
Western Blot Perforin Antibody (CB5.4) - BSA Free
(7 Publications)
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
RPLP1 Antibody
NBP1-81293
Immunohistochemistry-Paraffin RPLP1 Antibody
Immunohistochemistry-Paraffin RPLP1 Antibody
Immunohistochemistry-Paraffin RPLP1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
BAK Antibody
[Unconjugated]
AF816
Western Blot BAK Antibody [Unconjugated]
Immunocytochemistry BAK Antibody [Unconjugated]
Immunohistochemistry BAK Antibody [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, IHC, WB
BID Antibody
[Unconjugated]
AF860
Simple Western BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
(1 Review)
(40 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
VDAC1 Recombinant
Protein Antigen
NBP2-38163PEP
VDAC1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for VDAC1 Protein (NBP2-38163PEP) (0)

There are no publications for VDAC1 Protein (NBP2-38163PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VDAC1 Protein (NBP2-38163PEP) (0)

There are no reviews for VDAC1 Protein (NBP2-38163PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VDAC1 Protein (NBP2-38163PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VDAC1 Products

Research Areas for VDAC1 Protein (NBP2-38163PEP)

Find related products by research area.

Blogs on VDAC1

There are no specific blogs for VDAC1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for BID at approximately 29 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
BID Antibody [Unconjugated]
AF860

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VDAC1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol VDAC1