Home » Vang-like Protein 2/VANGL2 » Vang-like Protein 2/VANGL2 Proteins » Vang-like Protein 2/VANGL2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Vang-like Protein 2/VANGL2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Vang-like Protein 2/VANGL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VANGL2.

Source: E. coli

Amino Acid Sequence: QLQPQFTLKVVRSTDGASRFYNVGHLSIQRVAVWILEKYYHDFPVYNPALLNLPKSVLAKKVSGFKVYSLGEENSTNNSTGQSRAVIAAAARRRDNSHNEYYYEEAEHERRV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VANGL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81428.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vang-like Protein 2/VANGL2 Recombinant Protein Antigen

  • KIAA1215Loop-tail protein 1 homolog
  • loop-tail-associated protein
  • LPP1
  • LTAP
  • LTAPVan Gogh-like protein 2
  • MGC119403
  • MGC119404
  • STB1
  • STB1Strabismus 1
  • STBM
  • STBM1
  • Strabismus
  • vang (van gogh, Drosophila)-like 2, vang, van gogh-like 2 (Drosophila)
  • Vang like Protein 2
  • VANGL2
  • vang-like 2 (van gogh, Drosophila)
  • Vang-like Protein 2

Background

VANGL2 is involved in the control of early morphogenesis and patterning of both axial midline structures and the development of neural plate. It plays a role in the regulation of planar cell polarity, particularly in the orientation of stereociliary bundles in the cochlea. It is required for polarization and movement of myocardializing cells in the outflow tract and seems to act via RHOA signaling to regulate this process. The VANGL2 gene encodes a homolog of Drosophila 'strabismus/Van Gogh' (Stbm/Vang), a component of the frizzled-dishevelled tissue polarity pathway.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lysosomal Pro-X
Carboxypeptidase/PRCP ...
AF7164
Western Blot Lysosomal Pro-X Carboxypeptidase/PRCP Antibody
Species: Hu
Applications: WB
PGPEP-1 Antibody
AF6278
Western Blot PGPEP-1 Antibody
Species: Hu, Mu
Applications: WB
BMP-1/PCP Antibody
[Unconjugated]
AF1927
Western Blot BMP-1/PCP Antibody [Unconjugated]
Western Blot BMP-1/PCP Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: IP, WB
Vang-like Protein
1/VANGL1 Antibody
NBP1-86990
Western Blot Vang-like Protein 1/VANGL1 Antibody
Immunocytochemistry/ Immunofluorescence Vang-like Protein 1/VANGL1 Antibody
Western Blot Vang-like Protein 1/VANGL1 Antibody
(5 Publications)
Species: Hu, Mu
Applications: ICC/IF, KD, WB
Lipoprotein a
Antibody (4H1) - BSA
NBP2-37477
ELISA Lipoprotein a Antibody (4H1) - BSA Free
Western Blot Lipoprotein a Antibody (4H1) - BSA Free
Immunocytochemistry/ Immunofluorescence Lipoprotein a Antibody (4H1) - BSA Free
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Soluble
Liver/Pancreas Antige
NBP2-20454
Western Blot Soluble Liver/Pancreas Antigen Antibody
Immunohistochemistry-Paraffin Soluble Liver/Pancreas Antigen Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Dishevelled-1
Antibody
NBP2-24648
Western Blot Dishevelled-1 Antibody
Species: Hu, Mu, Pm, Rt
Applications: WB
Wnt-5a
[Unconjugated]
645-WN
Bioactivity Wnt-5a [Unconjugated]
(182 Publications)
Species: Hu, Mu
Applications: BA
CELSR1 Antibody
NBP3-30026
Immunoprecipitation CELSR1 Antibody
Species: Hu
Applications: IP, WB
FUZ Antibody
NBP2-24750
Western Blot FUZ Antibody
Immunohistochemistry-Paraffin FUZ Antibody
Species: Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(33 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
PRICKLE1 Antibody
- BSA Free
NBP2-81771
Western Blot PRICKLE1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRICKLE1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Dact1 Antibody
NBP2-24768
Western Blot Dact1 Antibody
Immunohistochemistry-Paraffin Dact1 Antibody
(1 Publication)
Species: Ch, Hu, Mu, Pm, Rt, Xp, Ze
Applications: IHC, IHC-P, WB
CD77 Synthase
Antibody
NBP1-62583
Western Blot CD77 Synthase Antibody
(2 Publications)
Species: Hu
Applications: WB
Frizzled-6 Antibody
AF1526
Immunocytochemistry/ Immunofluorescence Frizzled-6 Antibody
Immunocytochemistry/ Immunofluorescence Frizzled-6 Antibody
(19 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Vang-like Protein
2/VANGL2 Recombinant ...
NBP1-81428PEP
Vang-like Protein 2/VANGL2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP) (0)

There are no publications for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP) (0)

There are no reviews for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vang-like Protein 2/VANGL2 Products

Research Areas for Vang-like Protein 2/VANGL2 Protein (NBP1-81428PEP)

Find related products by research area.

Blogs on Vang-like Protein 2/VANGL2

There are no specific blogs for Vang-like Protein 2/VANGL2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Vang-like Protein 2/VANGL2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol VANGL2