V2 Vasopressin R/AVPR2 Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 232-371 of human AVPR2 (NP_000045.1). IHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
AVPR2 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for V2 Vasopressin R/AVPR2 Antibody - BSA Free
Background
The human AVPR2 locus encodes vasopressin receptor type 2, a member of the vasopressin/oxytocin family subfamily. V2 receptor has been shown to concentrate the urine and maintain water homeostasis by responding to the pituitary hormone arginine vasopressin (AVP). Loss of gene function results in the disease Nephrogenic Diabetes Insipidus (NDI). When extrarenal V2 receptors are stimulated by infusion of a V2 selective agonist (dDAVP), a variety of clotting factors are released into the bloodstream. The physiologic importance of this property is not known; its absence does not appear to be detrimental in NDI patients. The V2 receptor is expressed in the kidney tubule, predominantly in the distal convoluted tubule and collecting ducts. The V2 Receptor is also expressed outside the kidney although its tissue localization is uncertain. AVPR2 expression has also been described in brain, breast, fetal lung tissue and lung cancer associated with alternative splicing. ESTs have been isolated from normal lung and pancreatic cancer libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Publications for V2 Vasopressin R/AVPR2 Antibody (NBP2-93162) (0)
There are no publications for V2 Vasopressin R/AVPR2 Antibody (NBP2-93162).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for V2 Vasopressin R/AVPR2 Antibody (NBP2-93162) (0)
There are no reviews for V2 Vasopressin R/AVPR2 Antibody (NBP2-93162).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for V2 Vasopressin R/AVPR2 Antibody (NBP2-93162) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional V2 Vasopressin R/AVPR2 Products
Research Areas for V2 Vasopressin R/AVPR2 Antibody (NBP2-93162)
Find related products by research area.
|
Blogs on V2 Vasopressin R/AVPR2