Novus Biologicals products are now on bio-techne.com

USP10 Recombinant Protein Antigen

Name: USP10 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-83029PEP
Price: 289 USD

Images

There are currently no images for USP10 Protein (NBP1-83029PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

USP10 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USP10. Source: E. coli Amino Acid Sequence: KITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCNSPQNSTDS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	USP10
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83029. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	30 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for USP10 Recombinant Protein Antigen

Deubiquitinating enzyme 10
EC 3.4.19.12
KIAA0190MGC2621
ubiquitin carboxyl-terminal hydrolase 10
ubiquitin specific peptidase 10
ubiquitin specific protease 10
ubiquitin thioesterase 10
Ubiquitin Thiolesterase 10
Ubiquitin-specific-processing protease 10
UBPO
Uchrp
USP10

Background

Ubiquitin is a highly conserved protein that is covalently linked to other proteins to regulate their function and degradation. This gene encodes a member of the ubiquitin-specific protease family of cysteine proteases. The enzyme specifically cleaves ubiquitin from ubiquitin-conjugated protein substrates. The protein is found in the nucleus and cytoplasm. It functions as a co-factor of the DNA-bound androgen receptor complex, and is inhibited by a protein in the Ras-GTPase pathway. The human genome contains several pseudogenes similar to this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

UCH-L3 Antibody

NBP1-86037

Immunohistochemistry-Paraffin UCH-L3 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(43 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

G3BP1 Antibody
(2F3)

H00010146-M01

Immunocytochemistry/ Immunofluorescence G3BP1 Antibody (2F3)

Immunohistochemistry-Paraffin G3BP1 Antibody (2F3)

(8 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB

CFTR Antibody
(24-1) [Unconjugated] ...

MAB25031

Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus

(10 Reviews)

(76 Publications)

Species: Hu

Applications: IHC, IP, WB

Thymidylate
Synthase Antibody (HL ...

NBP3-25721

Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free

Species: Ca, Fe, Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Androgen R/NR3C4
[p Ser213, p Ser210] ...

NB100-56603

(14 Publications)

Species: Ca, Hu, Mu, Pm, Rt

Applications: IHC, IHC-P, WB

MDM2/HDM2 Antibody
(SMP14) - BSA Free

NB100-2736

Immunohistochemistry-Paraffin MDM2/HDM2 Antibody (SMP14) - BSA Free

(1 Review)

(22 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, IP, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(46 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

GPIP137 Antibody

NBP2-22238

(4 Reviews)

(1 Publication)

Species: Hu, Mu

Applications: IP, WB

Ferredoxin
Reductase Antibody

NBP2-38530

Immunohistochemistry-Paraffin Ferredoxin Reductase Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

PABP Antibody
(10E10) - BSA Free

NB120-6125

Western Blot PABP Antibody (10E10) - BSA Free

(1 Review)

(11 Publications)

Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB

TIA1 Antibody
(OTI1D7)

NBP2-46132

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Cav1.2 Antibody
(S57)

NBP1-22439

Immunohistochemistry Cav1.2 Antibody (S57)

(3 Publications)

Species: Ha, Hu, Mu, Rb, Rt

Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB

Survivin Antibody
- BSA Free

NB500-201

Dual RNAscope ISH-IHC Survivin Antibody - BSA Free

Knockdown Validated Survivin Antibody - BSA Free

(22 Reviews)

(378 Publications)

Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt

Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

CBL Antibody
(3B12) - BSA Free

NBP2-37574

Western Blot CBL Antibody (3B12) - BSA Free

(1 Review)

Species: Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Survivin Antibody
- BSA Free

NB500-201

(22 Reviews)

(378 Publications)

Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt

Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

E6AP/UBE3A
Antibody (2F6)

H00007337-M01

Immunocytochemistry/ Immunofluorescence E6AP/UBE3A Antibody (2F6)

(4 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB

Amphiregulin
Antibody

AF262

Immunocytochemistry Amphiregulin Antibody

Immunohistochemistry Amphiregulin Antibody

(1 Review)

(35 Publications)

Species: Hu

Applications: ICC, IHC, Neut, WB

ZNF645 Antibody

NBP2-21037

Immunohistochemistry-Paraffin ZNF645 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

USP10 Recombinant
Protein Antigen

NBP1-83029PEP

Species: Hu

Applications: AC

Publications for USP10 Protein (NBP1-83029PEP) (0)

There are no publications for USP10 Protein (NBP1-83029PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP10 Protein (NBP1-83029PEP) (0)

There are no reviews for USP10 Protein (NBP1-83029PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for USP10 Protein (NBP1-83029PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional USP10 Products

Research Areas for USP10 Protein (NBP1-83029PEP)

Find related products by research area.

Cell Biology

Blogs on USP10.

Check out the latest blog posts on USP10.

Beclin 1: Regulator of Autophagy and Apoptosis
Beclin 1 is the mammalian orthologue of the yeast Apg6/Vps30 gene. Beclin 1 can complement the defect in autophagy present in apg6 yeast strains and stimulate autophagy when overexpressed in mammalian cells (1) and can bind to Bcl2, an important regul... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: Survivin Antibody [NB500-201] - An intracellular stain was performed on HeLa cells with [NB500-201] and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.

Survivin Antibody - BSA Free
NB500-201

CFTR was detected in immersion fixed paraffin-embedded sections of human placenta using 8 µg/mL Mouse Anti-Human CFTR C-Terminus Monoclonal Antibody (Catalog # MAB25031) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-AEC Cell & Tissue Staining Kit (red; Catalog # CTS003) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.

CFTR Antibody (24-1) [Unconjugated] - C-terminus
MAB25031

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our USP10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

USP10

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

USP10 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

USP10 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for USP10 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for USP10 Protein (NBP1-83029PEP) (0)

Reviews for USP10 Protein (NBP1-83029PEP) (0)

FAQs for USP10 Protein (NBP1-83029PEP) (0)

Additional USP10 Products

Research Areas for USP10 Protein (NBP1-83029PEP)

Blogs on USP10.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics